Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-9606-01417
Entry Name
UniProt Accession
Theoretical PI
5.08
Molecular Weight
21184.41
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Apoptosis regulator BAX
Protein Synonyms/Alias
Bcl-2-like protein 4; Bcl2-L-4;
Gene Name
BAX
Gene Synonyms/Alias
BCL2L4;
Created Date
01-FEB-1995
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
126
Canonical
KLVLKALCTKVPELI
[1]
S-Palmitoylation
Organism
Homo sapiens (Human)
NCBI Taxa ID
9606
Reference
[1] Fröhlich M, Dejanovic B, Kashkar H, Schwarz G, Nussberger S. S-palmitoylation represents a novel mechanism regulating the mitochondrial targeting of BAX andinitiation of apoptosis. Cell Death Dis. 2014 Feb 13;5:e1057. doi:10.1038/cddis.2014.17.[PMID:24525733]
Functional Description
Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Sequence Annotation
Transmembrane: 172 192 Helical.
Motif: 59 73 BH3.
Motif: 98 118 BH1.
Motif: 150 165 BH2.
Modified residue: 1 1 N-acetylmethionine.
Protein Length
192 AA.
Protein Sequence
(Canonical)
MDGSGEQPRG GGPTSSEQIM KTGALLLQGF IQDRAGRMGG EAPELALDPV PQDASTKKLS  60
ECLKRIGDEL DSNMELQRMI AAVDTDSPRE VFFRVAADMF SDGNFNWGRV VALFYFASKL  120
VLKALCTKVP ELIRTIMGWT LDFLRERLLG WIQDQGGWDG LLSYFGTPTW QTVTIFVAGV  180
LTASLTIWKK MG                                                      192
FASTA
(Canonical)
>LipidDB-9606-01417|Q07812
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
Gene Ontology
GO:0097144; C:BAX complex; IDA:UniProtKB
GO:0097136; C:Bcl-2 family protein complex; IDA:UniProtKB
GO:0005829; C:cytosol; IDA:UniProtKB
GO:0005783; C:endoplasmic reticulum; IDA:HGNC
GO:0005789; C:endoplasmic reticulum membrane; IDA:HGNC
GO:0070062; C:extracellular vesicular exosome; IDA:UniProt
GO:0016020; C:membrane; IDA:UniProtKB
GO:0005741; C:mitochondrial outer membrane; IBA:RefGenome
GO:0005757; C:mitochondrial permeability transition pore complex; IDA:HGNC
GO:0005739; C:mitochondrion; IDA:UniProtKB
GO:0005634; C:nucleus; IMP:UniProtKB
GO:0046930; C:pore complex; IDA:BHF-UCL
GO:0051434; F:BH3 domain binding; IDA:UniProtKB
GO:0015267; F:channel activity; IDA:BHF-UCL
GO:0042802; F:identical protein binding; IPI:IntAct
GO:0008289; F:lipid binding; IDA:HGNC
GO:0046982; F:protein heterodimerization activity; IPI:HGNC
GO:0042803; F:protein homodimerization activity; IDA:HGNC
GO:0006919; P:activation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:HGNC
GO:0008635; P:activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c; IDA:HGNC
GO:0097296; P:activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway; IEA:Ensembl
GO:0008637; P:apoptotic mitochondrial changes; IDA:HGNC
GO:0006915; P:apoptotic process; NAS:UniProtKB
GO:1902263; P:apoptotic process involved in embryonic digit morphogenesis; IEA:Ensembl
GO:1902262; P:apoptotic process involved in patterning of blood vessels; IEA:Ensembl
GO:0097190; P:apoptotic signaling pathway; IDA:HGNC
GO:0001783; P:B cell apoptotic process; IDA:HGNC
GO:0001782; P:B cell homeostasis; IEA:Ensembl
GO:0002358; P:B cell homeostatic proliferation; IEA:Ensembl
GO:0002352; P:B cell negative selection; IEA:Ensembl
GO:1990117; P:B cell receptor apoptotic signaling pathway; IDA:BHF-UCL
GO:0001974; P:blood vessel remodeling; IEA:Ensembl
GO:0071310; P:cellular response to organic substance; IEA:Ensembl
GO:0034644; P:cellular response to UV; IEA:Ensembl
GO:0021987; P:cerebral cortex development; IEA:Ensembl
GO:0045136; P:development of secondary sexual characteristics; IEA:Ensembl
GO:0035234; P:ectopic germ cell programmed cell death; IEA:Ensembl
GO:0032469; P:endoplasmic reticulum calcium ion homeostasis; TAS:UniProtKB
GO:0010248; P:establishment or maintenance of transmembrane electrochemical gradient; IDA:HGNC
GO:0097191; P:extrinsic apoptotic signaling pathway; IDA:BHF-UCL
GO:0097192; P:extrinsic apoptotic signaling pathway in absence of ligand; IBA:RefGenome
GO:0008625; P:extrinsic apoptotic signaling pathway via death domain receptors; IC:BHF-UCL
GO:0009566; P:fertilization; IEA:Ensembl
GO:0007281; P:germ cell development; IEA:Ensembl
GO:0006687; P:glycosphingolipid metabolic process; IEA:Ensembl
GO:0048873; P:homeostasis of number of cells within a tissue; IEA:Ensembl
GO:0021854; P:hypothalamus development; IEA:Ensembl
GO:0097193; P:intrinsic apoptotic signaling pathway; IDA:BHF-UCL
GO:0072332; P:intrinsic apoptotic signaling pathway by p53 class mediator; IEA:Ensembl
GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; IBA:RefGenome
GO:0070059; P:intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress; IMP:UniProtKB
GO:0001822; P:kidney development; IEA:Ensembl
GO:0043653; P:mitochondrial fragmentation involved in apoptotic process; IDA:HGNC
GO:0008053; P:mitochondrial fusion; IDA:HGNC
GO:0070584; P:mitochondrion morphogenesis; IEA:Ensembl
GO:0002262; P:myeloid cell homeostasis; IEA:Ensembl
GO:2001234; P:negative regulation of apoptotic signaling pathway; IEA:Ensembl
GO:0032471; P:negative regulation of endoplasmic reticulum calcium ion concentration; IEA:Ensembl
GO:0048147; P:negative regulation of fibroblast proliferation; IEA:Ensembl
GO:0043524; P:negative regulation of neuron apoptotic process; IEA:Ensembl
GO:0033137; P:negative regulation of peptidyl-serine phosphorylation; IEA:Ensembl
GO:0032091; P:negative regulation of protein binding; IDA:UniProtKB
GO:0051402; P:neuron apoptotic process; IEA:Ensembl
GO:0001764; P:neuron migration; IEA:Ensembl
GO:0042475; P:odontogenesis of dentin-containing tooth; IEA:Ensembl
GO:0001541; P:ovarian follicle development; IEA:Ensembl
GO:1902512; P:positive regulation of apoptotic DNA fragmentation; IMP:BHF-UCL
GO:0043065; P:positive regulation of apoptotic process; IMP:UniProtKB
GO:0060058; P:positive regulation of apoptotic process involved in mammary gland involution; IEA:Ensembl
GO:0002904; P:positive regulation of B cell apoptotic process; IEA:Ensembl
GO:0048087; P:positive regulation of developmental pigmentation; IEA:Ensembl
GO:1900103; P:positive regulation of endoplasmic reticulum unfolded protein response; IMP:UniProtKB
GO:2001241; P:positive regulation of extrinsic apoptotic signaling pathway in absence of ligand; IEA:Ensembl
GO:2001244; P:positive regulation of intrinsic apoptotic signaling pathway; IMP:UniProtKB
GO:1901030; P:positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway; TAS:Reactome
GO:0043525; P:positive regulation of neuron apoptotic process; IDA:HGNC
GO:0032461; P:positive regulation of protein oligomerization; IDA:UniProtKB
GO:0090200; P:positive regulation of release of cytochrome c from mitochondria; IDA:UniProtKB
GO:0051281; P:positive regulation of release of sequestered calcium ion into cytosol; IEA:Ensembl
GO:0048597; P:post-embryonic camera-type eye morphogenesis; IEA:Ensembl
GO:0051260; P:protein homooligomerization; IDA:UniProtKB
GO:0001844; P:protein insertion into mitochondrial membrane involved in apoptotic signaling pathway; IEA:Ensembl
GO:0051259; P:protein oligomerization; IDA:UniProtKB
GO:0051726; P:regulation of cell cycle; IEA:Ensembl
GO:0033599; P:regulation of mammary gland epithelial cell proliferation; IEA:Ensembl
GO:1902445; P:regulation of mitochondrial membrane permeability involved in programmed necrotic cell death; IEA:Ensembl
GO:0051881; P:regulation of mitochondrial membrane potential; IDA:HGNC
GO:0006808; P:regulation of nitrogen utilization; IEA:Ensembl
GO:0043497; P:regulation of protein heterodimerization activity; IPI:HGNC
GO:0043496; P:regulation of protein homodimerization activity; IDA:HGNC
GO:0001836; P:release of cytochrome c from mitochondria; IDA:BHF-UCL
GO:0032976; P:release of matrix enzymes from mitochondria; IDA:HGNC
GO:0048678; P:response to axon injury; IEA:Ensembl
GO:0010332; P:response to gamma radiation; IEA:Ensembl
GO:0009651; P:response to salt stress; IEA:Ensembl
GO:0009636; P:response to toxic substance; IDA:HGNC
GO:0060041; P:retina development in camera-type eye; IEA:Ensembl
GO:1990009; P:retinal cell apoptotic process; IMP:HGNC
GO:0046666; P:retinal cell programmed cell death; IEA:Ensembl
GO:0060011; P:Sertoli cell proliferation; IEA:Ensembl
GO:0048515; P:spermatid differentiation; IEA:Ensembl
GO:0001777; P:T cell homeostatic proliferation; IEA:Ensembl
GO:0070242; P:thymocyte apoptotic process; IEA:Ensembl
GO:0006927; P:transformed cell apoptotic process; IMP:HGNC
GO:0060068; P:vagina development; IEA:Ensembl
GO:0016032; P:viral process; IEA:UniProtKB-KW
Interpro
InterPro; IPR026304; BAX
InterPro; IPR002475; Bcl2-like
InterPro; IPR020717; Bcl2_BH1_motif_CS
InterPro; IPR020726; Bcl2_BH2_motif_CS
InterPro; IPR020728; Bcl2_BH3_motif_CS
InterPro; IPR026298; Blc2_fam
Pfam
Pfam; PF00452; Bcl-2;
SMART
PROSITE
PROSITE; PS50062; BCL2_FAMILY;
PROSITE; PS01080; BH1;
PROSITE; PS01258; BH2;
PROSITE; PS01259; BH3;
PRINTS
PRINTS; PR01862; BCL2FAMILY;