Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-9606-01267
Entry Name
UniProt Accession
Theoretical PI
6.16
Molecular Weight
21258.61
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Cell division control protein 42 homolog
Protein Synonyms/Alias
G25K GTP-binding protein;
Gene Name
CDC42
Gene Synonyms/Alias
Created Date
13-APR-2004
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
188
Canonical
EPKKSRRCVLL****
[1]
S-Geranylgeranylation
Organism
Homo sapiens (Human)
NCBI Taxa ID
9606
Reference
[1] Gesi M, Pellegrini A, Soldani P, Lenzi P, Paparelli A, Danesi R, Nardini D,Macchia M. Ultrastructural and biochemical evidence of apoptosis induced by anovel inhibitor of protein geranylgeranylation in human MIA PaCa-2 pancreaticcancer cells. Ultrastruct Pathol. 1998 May-Jun;22(3):253-61.[PMID:9793206]
Functional Description
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Plays a role in the extension and maintenance of the formation of thin, actin-rich surface projections called filopodia. Mediates CDC42-dependent cell migration.
Sequence Annotation
Nucleotide-binding: 10 17 GTP.
Nucleotide-binding: 57 61 GTP.
Nucleotide-binding: 115 118 GTP.
Motif: 32 40 Effector region.
Modified residue: 32 32 O-AMP-tyrosine; by Haemophilus IbpA.
Modified residue: 35 35 O-AMP-threonine; by Vibrio VopS.
Modified residue: 64 64 Phosphotyrosine; by SRC.
Modified residue: 188 188 Cysteine methyl ester.
Protein Length
191 AA.
Protein Sequence
(Canonical)
MQTIKCVVVG DGAVGKTCLL ISYTTNKFPS EYVPTVFDNY AVTVMIGGEP YTLGLFDTAG  60
QEDYDRLRPL SYPQTDVFLV CFSVVSPSSF ENVKEKWVPE ITHHCPKTPF LLVGTQIDLR  120
DDPSTIEKLA KNKQKPITPE TAEKLARDLK AVKYVECSAL TQKGLKNVFD EAILAALEPP  180
EPKKSRRCVL L                                                       191
FASTA
(Canonical)
>LipidDB-9606-01267|P60953
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
Gene Ontology
GO:0045177; C:apical part of cell; IEA:Ensembl
GO:0005911; C:cell-cell junction; IEA:Ensembl
GO:0005737; C:cytoplasm; IDA:UniProtKB
GO:0036464; C:cytoplasmic ribonucleoprotein granule; IDA:ParkinsonsUK-UCL
GO:0005829; C:cytosol; TAS:Reactome
GO:0070062; C:extracellular vesicular exosome; IDA:UniProtKB
GO:0030175; C:filopodium; IDA:UniProtKB
GO:0005925; C:focal adhesion; IDA:UniProtKB
GO:0000139; C:Golgi membrane; ISS:BHF-UCL
GO:0031256; C:leading edge membrane; IEA:Ensembl
GO:0016020; C:membrane; IDA:UniProtKB
GO:0030496; C:midbody; IDA:UniProtKB
GO:0072686; C:mitotic spindle; IDA:UniProtKB
GO:0043005; C:neuron projection; IDA:BHF-UCL
GO:0043025; C:neuronal cell body; IDA:BHF-UCL
GO:0005886; C:plasma membrane; IDA:UniProtKB
GO:0030141; C:secretory granule; IEA:Ensembl
GO:0051233; C:spindle midzone; IDA:UniProtKB
GO:0034191; F:apolipoprotein A-I receptor binding; IPI:BHF-UCL
GO:0005525; F:GTP binding; IDA:MGI
GO:0003924; F:GTPase activity; TAS:UniProtKB
GO:0042802; F:identical protein binding; IPI:IntAct
GO:0019901; F:protein kinase binding; IDA:BHF-UCL
GO:0031996; F:thioesterase binding; IPI:UniProtKB
GO:0030036; P:actin cytoskeleton organization; IDA:UniProtKB
GO:0090135; P:actin filament branching; IEA:Ensembl
GO:0051017; P:actin filament bundle assembly; IEA:Ensembl
GO:0034332; P:adherens junction organization; IEA:Ensembl
GO:0007411; P:axon guidance; TAS:Reactome
GO:0007596; P:blood coagulation; TAS:Reactome
GO:0060070; P:canonical Wnt signaling pathway; IEA:Ensembl
GO:0003161; P:cardiac conduction system development; IEA:Ensembl
GO:0034613; P:cellular protein localization; IEA:Ensembl
GO:0036336; P:dendritic cell migration; IEA:Ensembl
GO:0007173; P:epidermal growth factor receptor signaling pathway; TAS:Reactome
GO:0090136; P:epithelial cell-cell adhesion; IEA:Ensembl
GO:0060684; P:epithelial-mesenchymal cell signaling; IEA:Ensembl
GO:0051683; P:establishment of Golgi localization; ISS:BHF-UCL
GO:0035088; P:establishment or maintenance of apical/basal cell polarity; IEA:Ensembl
GO:0007163; P:establishment or maintenance of cell polarity; TAS:UniProtKB
GO:0038096; P:Fc-gamma receptor signaling pathway involved in phagocytosis; TAS:Reactome
GO:0046847; P:filopodium assembly; IEA:Ensembl
GO:0007030; P:Golgi organization; ISS:BHF-UCL
GO:0006184; P:GTP catabolic process; TAS:GOC
GO:0031069; P:hair follicle morphogenesis; IEA:Ensembl
GO:0060789; P:hair follicle placode formation; IEA:Ensembl
GO:0060047; P:heart contraction; IEA:Ensembl
GO:0045087; P:innate immune response; TAS:Reactome
GO:0031424; P:keratinization; IEA:Ensembl
GO:0003334; P:keratinocyte development; IEA:Ensembl
GO:0030225; P:macrophage differentiation; TAS:UniProtKB
GO:0035264; P:multicellular organism growth; IEA:Ensembl
GO:0042692; P:muscle cell differentiation; TAS:Reactome
GO:0042059; P:negative regulation of epidermal growth factor receptor signaling pathway; TAS:Reactome
GO:0010629; P:negative regulation of gene expression; IEA:Ensembl
GO:0031333; P:negative regulation of protein complex assembly; IPI:UniProtKB
GO:0048664; P:neuron fate determination; IEA:Ensembl
GO:0007097; P:nuclear migration; IEA:Ensembl
GO:0051647; P:nucleus localization; IEA:Ensembl
GO:0072384; P:organelle transport along microtubule; ISS:BHF-UCL
GO:0032467; P:positive regulation of cytokinesis; IMP:UniProtKB
GO:0045740; P:positive regulation of DNA replication; IEA:Ensembl
GO:0010628; P:positive regulation of gene expression; IEA:Ensembl
GO:0071338; P:positive regulation of hair follicle cell proliferation; IEA:Ensembl
GO:0090316; P:positive regulation of intracellular protein transport; IEA:Ensembl
GO:0046330; P:positive regulation of JNK cascade; IEA:Ensembl
GO:0048554; P:positive regulation of metalloenzyme activity; IEA:Ensembl
GO:0051149; P:positive regulation of muscle cell differentiation; TAS:Reactome
GO:0043525; P:positive regulation of neuron apoptotic process; IEA:Ensembl
GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IEA:Ensembl
GO:0043552; P:positive regulation of phosphatidylinositol 3-kinase activity; IEA:Ensembl
GO:0031274; P:positive regulation of pseudopodium assembly; IDA:UniProtKB
GO:1900026; P:positive regulation of substrate adhesion-dependent cell spreading; IDA:UniProtKB
GO:0051835; P:positive regulation of synapse structural plasticity; IEA:Ensembl
GO:0051988; P:regulation of attachment of spindle microtubules to kinetochore; IMP:UniProtKB
GO:0051489; P:regulation of filopodium assembly; IDA:UniProtKB
GO:0007088; P:regulation of mitosis; IEA:Ensembl
GO:0042176; P:regulation of protein catabolic process; IEA:Ensembl
GO:0043497; P:regulation of protein heterodimerization activity; IEA:Ensembl
GO:0045859; P:regulation of protein kinase activity; IEA:Ensembl
GO:0031647; P:regulation of protein stability; IEA:Ensembl
GO:0051056; P:regulation of small GTPase mediated signal transduction; TAS:Reactome
GO:0007264; P:small GTPase mediated signal transduction; TAS:Reactome
GO:0002040; P:sprouting angiogenesis; IEA:Ensembl
GO:0060661; P:submandibular salivary gland formation; IEA:Ensembl
GO:0021762; P:substantia nigra development; IEP:UniProt
GO:0031295; P:T cell costimulation; TAS:Reactome
Interpro
InterPro; IPR027417; P-loop_NTPase
InterPro; IPR005225; Small_GTP-bd_dom
InterPro; IPR001806; Small_GTPase
InterPro; IPR003578; Small_GTPase_Rho
Pfam
Pfam; PF00071; Ras;
SMART
SMART; SM00174; RHO;
PROSITE
PROSITE; PS51420; RHO;
PRINTS
PRINTS; PR00449; RASTRNSFRMNG;