Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-9606-01217
Entry Name
UniProt Accession
Theoretical PI
8.09
Molecular Weight
49607.22
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Sonic hedgehog protein C-product
Protein Synonyms/Alias
SHH; HHG-1;
Gene Name
SHH
Gene Synonyms/Alias
Created Date
15-JUL-1999
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
24
Canonical
LVCSGLACGPGRGFG
[1]
S-Palmitoylation
Organism
Homo sapiens (Human)
NCBI Taxa ID
9606
Reference
[1] Bijlsma MF, Spek CA, Peppelenbosch MP. Hedgehog: an unusual signal transducer.Bioessays. 2004 Apr;26(4):387-94. Review.[PMID:15057936]
Functional Description
Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior- posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Activates the transcription of target genes by interacting with its receptor PTCH1 to prevent normal inhibition by PTCH1 on the constitutive signaling activity of SMO (By similarity).
Sequence Annotation
Metal binding site: 89 89 Calcium 1.
Metal binding site: 90 90 Calcium 1.
Metal binding site: 90 90 Calcium 2.
Metal binding site: 95 95 Calcium 1.
Metal binding site: 125 125 Calcium 1; via carbonyl oxygen.
Metal binding site: 126 126 Calcium 1.
Metal binding site: 126 126 Calcium 2.
Metal binding site: 129 129 Calcium 2.
Metal binding site: 131 131 Calcium 2.
Metal binding site: 140 140 Zinc.
Metal binding site: 147 147 Zinc.
Metal binding site: 182 182 Zinc.
Functional site: 197 198 Cleavage; by autolysis.
Functional site: 243 243 Involved in cholesterol transfer.
Functional site: 267 267 Involved in auto-cleavage.
Functional site: 270 270 Essential for auto-cleavage.
Protein Length
462 AA.
Protein Sequence
(Canonical)
MLLLARCLLL VLVSSLLVCS GLACGPGRGF GKRRHPKKLT PLAYKQFIPN VAEKTLGASG  60
RYEGKISRNS ERFKELTPNY NPDIIFKDEE NTGADRLMTQ RCKDKLNALA ISVMNQWPGV  120
KLRVTEGWDE DGHHSEESLH YEGRAVDITT SDRDRSKYGM LARLAVEAGF DWVYYESKAH  180
IHCSVKAENS VAAKSGGCFP GSATVHLEQG GTKLVKDLSP GDRVLAADDQ GRLLYSDFLT  240
FLDRDDGAKK VFYVIETREP RERLLLTAAH LLFVAPHNDS ATGEPEASSG SGPPSGGALG  300
PRALFASRVR PGQRVYVVAE RDGDRRLLPA AVHSVTLSEE AAGAYAPLTA QGTILINRVL  360
ASCYAVIEEH SWAHRAFAPF RLAHALLAAL APARTDRGGD SGGGDRGGGG GRVALTAPGA  420
ADAPGAGATA GIHWYSQLLY QIGTWLLDSE ALHPLGMAVK SS                     462
FASTA
(Canonical)
>LipidDB-9606-01217|Q15465
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
Gene Ontology
GO:0009986; C:cell surface; ISS:UniProtKB
GO:0031012; C:extracellular matrix; IEA:Ensembl
GO:0005615; C:extracellular space; IDA:UniProtKB
GO:0045121; C:membrane raft; ISS:UniProtKB
GO:0005634; C:nucleus; IEA:Ensembl
GO:0005886; C:plasma membrane; IEA:UniProtKB-KW
GO:0005509; F:calcium ion binding; IDA:UniProtKB
GO:0005539; F:glycosaminoglycan binding; IEA:Ensembl
GO:0043237; F:laminin-1 binding; ISS:UniProtKB
GO:0016015; F:morphogen activity; NAS:BHF-UCL
GO:0005113; F:patched binding; IDA:BHF-UCL
GO:0008233; F:peptidase activity; IEA:UniProtKB-KW
GO:0008270; F:zinc ion binding; IDA:UniProtKB
GO:0008209; P:androgen metabolic process; ISS:UniProtKB
GO:0097190; P:apoptotic signaling pathway; ISS:UniProt
GO:0060840; P:artery development; IEA:Ensembl
GO:0007411; P:axon guidance; ISS:UniProtKB
GO:0060020; P:Bergmann glial cell differentiation; IEA:Ensembl
GO:0007596; P:blood coagulation; IEA:Ensembl
GO:0060445; P:branching involved in salivary gland morphogenesis; IEA:Ensembl
GO:0001658; P:branching involved in ureteric bud morphogenesis; ISS:UniProtKB
GO:0048754; P:branching morphogenesis of an epithelial tube; ISS:UniProtKB
GO:0060447; P:bud outgrowth involved in lung branching; IEA:Ensembl
GO:0043010; P:camera-type eye development; IEA:Ensembl
GO:0060070; P:canonical Wnt signaling pathway; IEA:Ensembl
GO:0043369; P:CD4-positive or CD8-positive, alpha-beta T cell lineage commitment; IDA:BHF-UCL
GO:0048468; P:cell development; ISS:UniProtKB
GO:0001708; P:cell fate specification; ISS:UniProtKB
GO:0007267; P:cell-cell signaling; ISS:UniProtKB
GO:0071285; P:cellular response to lithium ion; IEA:Ensembl
GO:0007417; P:central nervous system development; ISS:UniProtKB
GO:0021930; P:cerebellar granule cell precursor proliferation; ISS:UniProtKB
GO:0003140; P:determination of left/right asymmetry in lateral mesoderm; ISS:BHF-UCL
GO:0021904; P:dorsal/ventral neural tube patterning; IEA:Ensembl
GO:0009953; P:dorsal/ventral pattern formation; ISS:UniProtKB
GO:0007398; P:ectoderm development; IEA:Ensembl
GO:0009790; P:embryo development; ISS:UniProtKB
GO:0048557; P:embryonic digestive tract morphogenesis; IEA:Ensembl
GO:0042733; P:embryonic digit morphogenesis; ISS:UniProtKB
GO:0048617; P:embryonic foregut morphogenesis; IEA:Ensembl
GO:0035115; P:embryonic forelimb morphogenesis; IEA:Ensembl
GO:0035116; P:embryonic hindlimb morphogenesis; IEA:Ensembl
GO:0030326; P:embryonic limb morphogenesis; ISS:UniProtKB
GO:0009880; P:embryonic pattern specification; TAS:BHF-UCL
GO:0048706; P:embryonic skeletal system development; IEA:Ensembl
GO:0006897; P:endocytosis; IEA:Ensembl
GO:0060664; P:epithelial cell proliferation involved in salivary gland morphogenesis; IEA:Ensembl
GO:0060738; P:epithelial-mesenchymal signaling involved in prostate gland development; IDA:MGI
GO:0030010; P:establishment of cell polarity; IEA:Ensembl
GO:0030900; P:forebrain development; ISS:UniProtKB
GO:0048859; P:formation of anatomical boundary; IEA:Ensembl
GO:0031069; P:hair follicle morphogenesis; IEA:Ensembl
GO:0007507; P:heart development; ISS:UniProtKB
GO:0001947; P:heart looping; ISS:BHF-UCL
GO:0030902; P:hindbrain development; ISS:UniProtKB
GO:0007442; P:hindgut morphogenesis; IEA:Ensembl
GO:0048839; P:inner ear development; IEA:Ensembl
GO:0016539; P:intein-mediated protein splicing; IEA:InterPro
GO:0045109; P:intermediate filament organization; IEA:Ensembl
GO:0060459; P:left lung development; IEA:Ensembl
GO:0060174; P:limb bud formation; IEA:Ensembl
GO:0030324; P:lung development; ISS:UniProtKB
GO:0060428; P:lung epithelium development; IEA:Ensembl
GO:0060463; P:lung lobe morphogenesis; IEA:Ensembl
GO:0060484; P:lung-associated mesenchyme development; IEA:Ensembl
GO:0002320; P:lymphoid progenitor cell differentiation; IMP:BHF-UCL
GO:0030539; P:male genitalia development; ISS:UniProtKB
GO:0060916; P:mesenchymal cell proliferation involved in lung development; IEA:Ensembl
GO:0060783; P:mesenchymal smoothened signaling pathway involved in prostate gland development; IEA:Ensembl
GO:0072136; P:metanephric mesenchymal cell proliferation involved in metanephros development; ISS:UniProtKB
GO:0001656; P:metanephros development; ISS:UniProtKB
GO:0030901; P:midbrain development; ISS:UniProtKB
GO:0080125; P:multicellular structure septum development; IEA:Ensembl
GO:0045445; P:myoblast differentiation; IEA:Ensembl
GO:0014902; P:myotube differentiation; IEA:Ensembl
GO:0046639; P:negative regulation of alpha-beta T cell differentiation; IEA:Ensembl
GO:0043066; P:negative regulation of apoptotic process; ISS:UniProt
GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IEA:Ensembl
GO:0045596; P:negative regulation of cell differentiation; ISS:UniProtKB
GO:0030336; P:negative regulation of cell migration; ISS:UniProtKB
GO:0090370; P:negative regulation of cholesterol efflux; ISS:BHF-UCL
GO:2000357; P:negative regulation of kidney smooth muscle cell differentiation; ISS:UniProtKB
GO:2001054; P:negative regulation of mesenchymal cell apoptotic process; IEA:Ensembl
GO:0032435; P:negative regulation of proteasomal ubiquitin-dependent protein catabolic process; IEA:Ensembl
GO:0042130; P:negative regulation of T cell proliferation; IEA:Ensembl
GO:0034244; P:negative regulation of transcription elongation from RNA polymerase II promoter; IEA:Ensembl
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; ISS:BHF-UCL
GO:2000062; P:negative regulation of ureter smooth muscle cell differentiation; ISS:UniProtKB
GO:0045060; P:negative thymic T cell selection; ISS:UniProtKB
GO:0001755; P:neural crest cell migration; ISS:UniProtKB
GO:0007405; P:neuroblast proliferation; ISS:UniProtKB
GO:0048663; P:neuron fate commitment; ISS:UniProtKB
GO:0042475; P:odontogenesis of dentin-containing tooth; IEA:Ensembl
GO:0014003; P:oligodendrocyte development; IEA:Ensembl
GO:0048645; P:organ formation; IEA:Ensembl
GO:0002076; P:osteoblast development; IEA:Ensembl
GO:0060021; P:palate development; IEA:Ensembl
GO:0031016; P:pancreas development; IEA:Ensembl
GO:0007389; P:pattern specification process; ISS:UniProtKB
GO:0001569; P:patterning of blood vessels; ISS:UniProtKB
GO:0009949; P:polarity specification of anterior/posterior axis; ISS:UniProt
GO:0046638; P:positive regulation of alpha-beta T cell differentiation; ISS:UniProtKB
GO:0051781; P:positive regulation of cell division; IDA:BHF-UCL
GO:0008284; P:positive regulation of cell proliferation; ISS:UniProtKB
GO:0060769; P:positive regulation of epithelial cell proliferation involved in prostate gland development; IEA:Ensembl
GO:0007228; P:positive regulation of hh target transcription factor activity; ISS:BHF-UCL
GO:0033092; P:positive regulation of immature T cell proliferation in thymus; ISS:BHF-UCL
GO:2000358; P:positive regulation of kidney smooth muscle cell differentiation; ISS:UniProtKB
GO:2000729; P:positive regulation of mesenchymal cell proliferation involved in ureter development; ISS:UniProtKB
GO:0002052; P:positive regulation of neuroblast proliferation; IEA:Ensembl
GO:0048714; P:positive regulation of oligodendrocyte differentiation; IEA:Ensembl
GO:0042307; P:positive regulation of protein import into nucleus; IEA:Ensembl
GO:0061189; P:positive regulation of sclerotome development; IDA:BHF-UCL
GO:0014858; P:positive regulation of skeletal muscle cell proliferation; IEA:Ensembl
GO:0048643; P:positive regulation of skeletal muscle tissue development; IEA:Ensembl
GO:0045880; P:positive regulation of smoothened signaling pathway; IDA:UniProtKB
GO:0051155; P:positive regulation of striated muscle cell differentiation; IEA:Ensembl
GO:0033089; P:positive regulation of T cell differentiation in thymus; ISS:UniProtKB
GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; ISS:BHF-UCL
GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:BHF-UCL
GO:2000063; P:positive regulation of ureter smooth muscle cell differentiation; ISS:UniProtKB
GO:0030177; P:positive regulation of Wnt signaling pathway; IEA:Ensembl
GO:0045059; P:positive thymic T cell selection; ISS:UniProtKB
GO:0060516; P:primary prostatic bud elongation; IEA:Ensembl
GO:0060523; P:prostate epithelial cord elongation; IEA:Ensembl
GO:0030850; P:prostate gland development; ISS:UniProtKB
GO:0034504; P:protein localization to nucleus; IEA:Ensembl
GO:0042127; P:regulation of cell proliferation; ISS:UniProtKB
GO:0060782; P:regulation of mesenchymal cell proliferation involved in prostate gland development; IEA:Ensembl
GO:1900175; P:regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry; NAS:BHF-UCL
GO:0042481; P:regulation of odontogenesis; ISS:BHF-UCL
GO:0060685; P:regulation of prostatic bud formation; IEA:Ensembl
GO:1900180; P:regulation of protein localization to nucleus; IDA:BHF-UCL
GO:0030162; P:regulation of proteolysis; ISS:UniProtKB
GO:0072001; P:renal system development; IEP:UniProtKB
GO:0060458; P:right lung development; IEA:Ensembl
GO:0060662; P:salivary gland cavitation; IEA:Ensembl
GO:0007224; P:smoothened signaling pathway; IEP:UniProtKB
GO:0021938; P:smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation; IEA:Ensembl
GO:0061053; P:somite development; ISS:BHF-UCL
GO:0021513; P:spinal cord dorsal/ventral patterning; IEA:Ensembl
GO:0021522; P:spinal cord motor neuron differentiation; IEA:Ensembl
GO:0048864; P:stem cell development; ISS:UniProtKB
GO:0014706; P:striated muscle tissue development; IEA:Ensembl
GO:0033077; P:T cell differentiation in thymus; ISS:BHF-UCL
GO:0021978; P:telencephalon regionalization; IEA:Ensembl
GO:0021794; P:thalamus development; IEA:Ensembl
GO:0048538; P:thymus development; ISS:UniProtKB
GO:0030878; P:thyroid gland development; IEA:Ensembl
GO:0060439; P:trachea morphogenesis; IEA:Ensembl
GO:0001570; P:vasculogenesis; ISS:UniProtKB
GO:0007418; P:ventral midline development; TAS:BHF-UCL
Interpro
InterPro; IPR001657; Hedgehog
InterPro; IPR028992; Hedgehog/Intein_dom
InterPro; IPR009045; Hedgehog_sig/DD-Pept_Zn-bd_dom
InterPro; IPR000320; Hedgehog_signalling_dom
InterPro; IPR001767; Hint_dom
InterPro; IPR003586; Hint_dom_C
InterPro; IPR003587; Hint_dom_N
InterPro; IPR006141; Intein_splice_site
Pfam
Pfam; PF01085; HH_signal;
Pfam; PF01079; Hint;
SMART
SMART; SM00305; HintC;
SMART; SM00306; HintN;
PROSITE
PROSITE; PS50817; INTEIN_N_TER;
PRINTS
PRINTS; PR00632; SONICHHOG;