Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-9606-00998
Entry Name
UniProt Accession
Theoretical PI
6.44
Molecular Weight
25644.42
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Tumor necrosis factor, soluble form
Protein Synonyms/Alias
Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; N-terminal fragment; NTF; ICD1; ICD2;
Gene Name
TNF
Gene Synonyms/Alias
TNFA; TNFSF2;
Created Date
21-JUL-1986
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
19
Canonical
LAEEALPKKTGGPQG
[2]
N-Myristoylation
20
Canonical
AEEALPKKTGGPQGS
[2]
N-Myristoylation
30
Canonical
GPQGSRRCLFLSLFS
[1]
S-Palmitoylation
Organism
Homo sapiens (Human)
NCBI Taxa ID
9606
Reference
[1] Utsumi T, Takeshige T, Tanaka K, Takami K, Kira Y, Klostergaard J, Ishisaka R.Transmembrane TNF (pro-TNF) is palmitoylated. FEBS Lett. 2001 Jun29;500(1-2):1-6.[PMID:11434916]
[2] Stevenson FT, Bursten SL, Locksley RM, Lovett DH. Myristyl acylation of thetumor necrosis factor alpha precursor on specific lysine residues. J Exp Med.1992 Oct 1;176(4):1053-62.[PMID:1402651]
Functional Description
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
Sequence Annotation
Topological domain: 1 35 Cytoplasmic.
Transmembrane: 36 56 Helical; Signal-anchor for type IImembrane protein.
Topological domain: 57 233 Extracellular.
Functional site: 35 36 Cleavage; by SPPL2A or SPPL2B.
Functional site: 39 40 Cleavage; by SPPL2A or SPPL2B.
Functional site: 49 50 Cleavage; by SPPL2A or SPPL2B.
Functional site: 51 52 Cleavage; by SPPL2A or SPPL2B.
Functional site: 76 77 Cleavage; by ADAM17.
Modified residue: 2 2 Phosphoserine; by CK1.
Protein Length
233 AA.
Protein Sequence
(Canonical)
MSTESMIRDV ELAEEALPKK TGGPQGSRRC LFLSLFSFLI VAGATTLFCL LHFGVIGPQR  60
EEFPRDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR  120
DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE  180
TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINRPDYLDF AESGQVYFGI IAL         233
MSTESMIRDV ELAEEALPKK TGGPQGSRRC LFLSLFSFLI VAGATTLFCL LHFGVIGPQR  60
EEFPRDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR  120
DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE  180
TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINRPDYLDF AESGQVYFGI IAL         233
FASTA
(Canonical)
>LipidDB-9606-00998|P01375
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Gene Ontology
GO:0009986; C:cell surface; IDA:BHF-UCL
GO:0009897; C:external side of plasma membrane; ISS:BHF-UCL
GO:0005576; C:extracellular region; TAS:Reactome
GO:0005615; C:extracellular space; IDA:BHF-UCL
GO:0005887; C:integral component of plasma membrane; IDA:BHF-UCL
GO:0045121; C:membrane raft; IDA:BHF-UCL
GO:0001891; C:phagocytic cup; ISS:BHF-UCL
GO:0005886; C:plasma membrane; TAS:Reactome
GO:0055037; C:recycling endosome; ISS:BHF-UCL
GO:0005125; F:cytokine activity; IDA:BHF-UCL
GO:0042802; F:identical protein binding; IDA:BHF-UCL
GO:0002020; F:protease binding; IPI:BHF-UCL
GO:0044212; F:transcription regulatory region DNA binding; IDA:UniProtKB
GO:0005164; F:tumor necrosis factor receptor binding; IDA:BHF-UCL
GO:0006919; P:activation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:UniProtKB
GO:0000187; P:activation of MAPK activity; IDA:BHF-UCL
GO:0000185; P:activation of MAPKKK activity; IDA:BHF-UCL
GO:0006915; P:apoptotic process; TAS:Reactome
GO:0097190; P:apoptotic signaling pathway; TAS:Reactome
GO:0019722; P:calcium-mediated signaling; IEA:Ensembl
GO:0001775; P:cell activation; IEA:Ensembl
GO:0071230; P:cellular response to amino acid stimulus; IEA:Ensembl
GO:0071316; P:cellular response to nicotine; IDA:UniProtKB
GO:0071407; P:cellular response to organic cyclic compound; IDA:UniProtKB
GO:0002439; P:chronic inflammatory response to antigenic stimulus; IMP:BHF-UCL
GO:0050830; P:defense response to Gram-positive bacterium; IEA:Ensembl
GO:0048566; P:embryonic digestive tract development; IEP:DFLAT
GO:0060664; P:epithelial cell proliferation involved in salivary gland morphogenesis; IEA:Ensembl
GO:0030198; P:extracellular matrix organization; IEA:Ensembl
GO:0097191; P:extrinsic apoptotic signaling pathway; IDA:UniProtKB
GO:0008625; P:extrinsic apoptotic signaling pathway via death domain receptors; IDA:UniProtKB
GO:0006006; P:glucose metabolic process; IEA:Ensembl
GO:0006959; P:humoral immune response; IEA:Ensembl
GO:0006954; P:inflammatory response; IDA:UniProtKB
GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; IEA:Ensembl
GO:0007254; P:JNK cascade; IEA:Ensembl
GO:0050901; P:leukocyte tethering or rolling; IDA:BHF-UCL
GO:0031663; P:lipopolysaccharide-mediated signaling pathway; IDA:UniProtKB
GO:0000165; P:MAPK cascade; IMP:UniProtKB
GO:0097527; P:necroptotic signaling pathway; IDA:UniProtKB
GO:0010693; P:negative regulation of alkaline phosphatase activity; IEA:Ensembl
GO:0061048; P:negative regulation of branching involved in lung morphogenesis; IDA:UniProtKB
GO:0008285; P:negative regulation of cell proliferation; IEA:Ensembl
GO:0002740; P:negative regulation of cytokine secretion involved in immune response; IDA:BHF-UCL
GO:2001240; P:negative regulation of extrinsic apoptotic signaling pathway in absence of ligand; IDA:BHF-UCL
GO:0045599; P:negative regulation of fat cell differentiation; NAS:BHF-UCL
GO:0010629; P:negative regulation of gene expression; IDA:UniProtKB
GO:0046325; P:negative regulation of glucose import; IEA:Ensembl
GO:0044130; P:negative regulation of growth of symbiont in host; IEA:Ensembl
GO:0032715; P:negative regulation of interleukin-6 production; IDA:BHF-UCL
GO:0002037; P:negative regulation of L-glutamate transport; IEA:Ensembl
GO:0050995; P:negative regulation of lipid catabolic process; IDA:BHF-UCL
GO:0010888; P:negative regulation of lipid storage; NAS:BHF-UCL
GO:0045668; P:negative regulation of osteoblast differentiation; IEA:Ensembl
GO:0043242; P:negative regulation of protein complex disassembly; IDA:UniProtKB
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:UniProtKB
GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB
GO:0045071; P:negative regulation of viral genome replication; IDA:BHF-UCL
GO:0009887; P:organ morphogenesis; IEA:Ensembl
GO:0030316; P:osteoclast differentiation; IEA:Ensembl
GO:0043065; P:positive regulation of apoptotic process; IDA:UniProtKB
GO:0060559; P:positive regulation of calcidiol 1-monooxygenase activity; IDA:BHF-UCL
GO:2000343; P:positive regulation of chemokine (C-X-C motif) ligand 2 production; IDA:BHF-UCL
GO:0045080; P:positive regulation of chemokine biosynthetic process; IDA:BHF-UCL
GO:0032722; P:positive regulation of chemokine production; IDA:BHF-UCL
GO:0002876; P:positive regulation of chronic inflammatory response to antigenic stimulus; IEA:Ensembl
GO:0043280; P:positive regulation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:UniProtKB
GO:0001819; P:positive regulation of cytokine production; IDA:BHF-UCL
GO:0050715; P:positive regulation of cytokine secretion; IDA:BHF-UCL
GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; NAS:BHF-UCL
GO:0031622; P:positive regulation of fever generation; ISS:BHF-UCL
GO:0010628; P:positive regulation of gene expression; IDA:AgBase
GO:0051798; P:positive regulation of hair follicle development; IEA:Ensembl
GO:0034116; P:positive regulation of heterotypic cell-cell adhesion; IDA:BHF-UCL
GO:0002925; P:positive regulation of humoral immune response mediated by circulating immunoglobulin; IEA:Ensembl
GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IDA:BHF-UCL
GO:0032729; P:positive regulation of interferon-gamma production; IEA:Ensembl
GO:0032741; P:positive regulation of interleukin-18 production; IEA:Ensembl
GO:0032755; P:positive regulation of interleukin-6 production; IEA:Ensembl
GO:0045416; P:positive regulation of interleukin-8 biosynthetic process; IDA:BHF-UCL
GO:0046330; P:positive regulation of JNK cascade; IEA:Ensembl
GO:0043507; P:positive regulation of JUN kinase activity; IDA:UniProtKB
GO:0043406; P:positive regulation of MAP kinase activity; IDA:UniProtKB
GO:0051044; P:positive regulation of membrane protein ectodomain proteolysis; IDA:BHF-UCL
GO:0045840; P:positive regulation of mitosis; IEA:Ensembl
GO:0071677; P:positive regulation of mononuclear cell migration; NAS:BHF-UCL
GO:0043525; P:positive regulation of neuron apoptotic process; IEA:Ensembl
GO:0042346; P:positive regulation of NF-kappaB import into nucleus; IDA:BHF-UCL
GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; IDA:UniProtKB
GO:0051533; P:positive regulation of NFAT protein import into nucleus; IDA:MGI
GO:0045429; P:positive regulation of nitric oxide biosynthetic process; IDA:BHF-UCL
GO:0045672; P:positive regulation of osteoclast differentiation; IDA:BHF-UCL
GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IDA:BHF-UCL
GO:0071803; P:positive regulation of podosome assembly; IDA:BHF-UCL
GO:0043068; P:positive regulation of programmed cell death; IDA:UniProtKB
GO:0031334; P:positive regulation of protein complex assembly; IDA:BHF-UCL
GO:0043243; P:positive regulation of protein complex disassembly; IDA:UniProtKB
GO:0051897; P:positive regulation of protein kinase B signaling; IEA:Ensembl
GO:2000010; P:positive regulation of protein localization to cell surface; IDA:BHF-UCL
GO:0001934; P:positive regulation of protein phosphorylation; IDA:UniProtKB
GO:0051222; P:positive regulation of protein transport; IDA:BHF-UCL
GO:0051091; P:positive regulation of sequence-specific DNA binding transcription factor activity; IDA:BHF-UCL
GO:0048661; P:positive regulation of smooth muscle cell proliferation; IDA:BHF-UCL
GO:0050806; P:positive regulation of synaptic transmission; IEA:Ensembl
GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:UniProtKB
GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB
GO:0045994; P:positive regulation of translational initiation by iron; IEA:Ensembl
GO:0060557; P:positive regulation of vitamin D biosynthetic process; IDA:BHF-UCL
GO:0000060; P:protein import into nucleus, translocation; IDA:UniProtKB
GO:0043491; P:protein kinase B signaling; IMP:UniProtKB
GO:0032800; P:receptor biosynthetic process; IDA:BHF-UCL
GO:0060693; P:regulation of branching involved in salivary gland morphogenesis; IEA:Ensembl
GO:0043122; P:regulation of I-kappaB kinase/NF-kappaB signaling; IDA:BHF-UCL
GO:0051023; P:regulation of immunoglobulin secretion; IEA:Ensembl
GO:0050796; P:regulation of insulin secretion; IDA:BHF-UCL
GO:2000377; P:regulation of reactive oxygen species metabolic process; IEA:Ensembl
GO:0014823; P:response to activity; IEA:Ensembl
GO:0042493; P:response to drug; IEA:Ensembl
GO:0051384; P:response to glucocorticoid; IDA:BHF-UCL
GO:0001666; P:response to hypoxia; IEA:Ensembl
GO:0009612; P:response to mechanical stimulus; IEA:Ensembl
GO:0009651; P:response to salt stress; TAS:BHF-UCL
GO:0009615; P:response to virus; IDA:BHF-UCL
GO:0030730; P:sequestering of triglyceride; IDA:BHF-UCL
GO:0003009; P:skeletal muscle contraction; IEA:Ensembl
GO:0006927; P:transformed cell apoptotic process; IDA:BHF-UCL
GO:0033209; P:tumor necrosis factor-mediated signaling pathway; IMP:BHF-UCL
Interpro
InterPro; IPR006053; TNF
InterPro; IPR002959; TNF_alpha
InterPro; IPR021184; TNF_CS
InterPro; IPR006052; TNF_dom
InterPro; IPR008983; Tumour_necrosis_fac-like_dom
Pfam
Pfam; PF00229; TNF;
SMART
SMART; SM00207; TNF;
PROSITE
PROSITE; PS00251; TNF_1;
PROSITE; PS50049; TNF_2;
PRINTS
PRINTS; PR01234; TNECROSISFCT;
PRINTS; PR01235; TNFALPHA;