Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-9606-00973
Entry Name
UniProt Accession
Theoretical PI
5.18
Molecular Weight
52667.84
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Presenilin-1 CTF12
Protein Synonyms/Alias
PS-1; 3.4.23.-; Protein S182; PS1-CTF12;
Gene Name
PSEN1
Gene Synonyms/Alias
AD3; PS1; PSNL1;
Created Date
01-OCT-1996
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
263
Canonical
YDLVAVLCPKGPLRM
[1]
S-Palmitoylation
Organism
Homo sapiens (Human)
NCBI Taxa ID
9606
Reference
[1] Predicted from GPS-Lipid
Functional Description
Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. Stimulates cell-cell adhesion though its association with the E-cadherin/catenin complex. Under conditions of apoptosis or calcium influx, cleaves E-cadherin promoting the disassembly of the E-cadherin/catenin complex and increasing the pool of cytoplasmic beta-catenin, thus negatively regulating Wnt signaling. May also play a role in hematopoiesis.
Sequence Annotation
Topological domain: 1 82 Cytoplasmic.
Transmembrane: 83 103 Helical.
Topological domain: 104 132 Lumenal.
Transmembrane: 133 153 Helical.
Topological domain: 154 160 Cytoplasmic.
Transmembrane: 161 181 Helical.
Topological domain: 182 190 Lumenal.
Transmembrane: 191 211 Helical.
Topological domain: 212 220 Cytoplasmic.
Transmembrane: 221 241 Helical.
Topological domain: 242 243 Lumenal.
Transmembrane: 244 264 Helical.
Topological domain: 265 380 Cytoplasmic.
Transmembrane: 381 401 Helical.
Topological domain: 402 407 Lumenal.
Transmembrane: 408 428 Helical.
Topological domain: 429 432 Cytoplasmic.
Topological domain: 454 467 Cytoplasmic.
Region: 322 450 Required for interaction with CTNNB1.
Region: 372 399 Required for interaction with CTNND2.
Region: 464 467 Interaction with MTCH1.
Motif: 433 435 PAL.
Active site: 257 257
Active site: 385 385
Functional site: 291 292 Cleavage; alternate.
Functional site: 292 293 Cleavage; alternate.
Functional site: 298 299 Cleavage.
Functional site: 345 346 Cleavage; by caspase.
Modified residue: 43 43 Phosphoserine.
Modified residue: 310 310 Phosphoserine; by PKA.
Modified residue: 346 346 Phosphoserine; by PKC.
Modified residue: 367 367 Phosphoserine.
Protein Length
467 AA.
Protein Sequence
(Canonical)
MTELPAPLSY FQNAQMSEDN HLSNTVRSQN DNRERQEHND RRSLGHPEPL SNGRPQGNSR  60
QVVEQDEEED EELTLKYGAK HVIMLFVPVT LCMVVVVATI KSVSFYTRKD GQLIYTPFTE  120
DTETVGQRAL HSILNAAIMI SVIVVMTILL VVLYKYRCYK VIHAWLIISS LLLLFFFSFI  180
YLGEVFKTYN VAVDYITVAL LIWNFGVVGM ISIHWKGPLR LQQAYLIMIS ALMALVFIKY  240
LPEWTAWLIL AVISVYDLVA VLCPKGPLRM LVETAQERNE TLFPALIYSS TMVWLVNMAE  300
GDPEAQRRVS KNSKYNAEST ERESQDTVAE NDDGGFSEEW EAQRDSHLGP HRSTPESRAA  360
VQELSSSILA GEDPEERGVK LGLGDFIFYS VLVGKASATA SGDWNTTIAC FVAILIGLCL  420
TLLLLAIFKK ALPALPISIT FGLVFYFATD YLVQPFMDQL AFHQFYI                467
FASTA
(Canonical)
>LipidDB-9606-00973|P49768
MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
Gene Ontology
GO:0016324; C:apical plasma membrane; IBA:RefGenome
GO:0030424; C:axon; IBA:RefGenome
GO:0005938; C:cell cortex; IBA:RefGenome
GO:0009986; C:cell surface; IBA:RefGenome
GO:0005813; C:centrosome; IDA:UniProtKB
GO:0035253; C:ciliary rootlet; IBA:RefGenome
GO:0031410; C:cytoplasmic vesicle; IEA:Ensembl
GO:0043198; C:dendritic shaft; IBA:RefGenome
GO:0005783; C:endoplasmic reticulum; IDA:HGNC
GO:0070765; C:gamma-secretase complex; IDA:UniProtKB
GO:0005794; C:Golgi apparatus; IDA:UniProtKB
GO:0030426; C:growth cone; IBA:RefGenome
GO:0016021; C:integral component of membrane; TAS:UniProtKB
GO:0005887; C:integral component of plasma membrane; IDA:HGNC
GO:0000776; C:kinetochore; IDA:UniProtKB
GO:0005765; C:lysosomal membrane; IBA:RefGenome
GO:0016020; C:membrane; IDA:MGI
GO:0045121; C:membrane raft; IDA:UniProt
GO:0005743; C:mitochondrial inner membrane; IBA:RefGenome
GO:0005739; C:mitochondrion; IDA:UniProtKB
GO:0031594; C:neuromuscular junction; IBA:RefGenome
GO:0043025; C:neuronal cell body; IBA:RefGenome
GO:0031965; C:nuclear membrane; IDA:UniProtKB
GO:0005640; C:nuclear outer membrane; IDA:MGI
GO:0048471; C:perinuclear region of cytoplasm; IBA:RefGenome
GO:0005791; C:rough endoplasmic reticulum; IDA:UniProtKB
GO:0005790; C:smooth endoplasmic reticulum; IDA:UniProtKB
GO:0030018; C:Z disc; IBA:RefGenome
GO:0004190; F:aspartic-type endopeptidase activity; IEA:InterPro
GO:0008013; F:beta-catenin binding; IPI:UniProtKB
GO:0045296; F:cadherin binding; IBA:RefGenome
GO:0005262; F:calcium channel activity; IMP:UniProtKB
GO:0004175; F:endopeptidase activity; IDA:MGI
GO:0030165; F:PDZ domain binding; IPI:UniProtKB
GO:0000186; P:activation of MAPKK activity; IEA:Ensembl
GO:0042987; P:amyloid precursor protein catabolic process; TAS:HGNC
GO:0042640; P:anagen; IEA:Ensembl
GO:0000045; P:autophagic vacuole assembly; IEA:Ensembl
GO:0034205; P:beta-amyloid formation; IEA:Ensembl
GO:0050435; P:beta-amyloid metabolic process; IBA:RefGenome
GO:0001568; P:blood vessel development; IEA:Ensembl
GO:0048854; P:brain morphogenesis; IEA:Ensembl
GO:0021870; P:Cajal-Retzius cell differentiation; IEA:Ensembl
GO:0070588; P:calcium ion transmembrane transport; IMP:GOC
GO:0060070; P:canonical Wnt signaling pathway; IBA:RefGenome
GO:0001708; P:cell fate specification; IEA:Ensembl
GO:0006974; P:cellular response to DNA damage stimulus; IEA:Ensembl
GO:0021795; P:cerebral cortex cell migration; IEA:Ensembl
GO:0015871; P:choline transport; IEA:Ensembl
GO:0021904; P:dorsal/ventral neural tube patterning; IEA:Ensembl
GO:0030326; P:embryonic limb morphogenesis; IEA:Ensembl
GO:0032469; P:endoplasmic reticulum calcium ion homeostasis; IGI:UniProtKB
GO:0050673; P:epithelial cell proliferation; IEA:Ensembl
GO:0022617; P:extracellular matrix disassembly; TAS:Reactome
GO:0030198; P:extracellular matrix organization; TAS:Reactome
GO:0001947; P:heart looping; IEA:Ensembl
GO:0002244; P:hematopoietic progenitor cell differentiation; IEA:Ensembl
GO:0035556; P:intracellular signal transduction; IEA:InterPro
GO:0015813; P:L-glutamate transport; IEA:Ensembl
GO:0006509; P:membrane protein ectodomain proteolysis; IDA:HGNC
GO:0007613; P:memory; IEA:Ensembl
GO:0006839; P:mitochondrial transport; IEA:Ensembl
GO:0002573; P:myeloid leukocyte differentiation; IEA:Ensembl
GO:0043066; P:negative regulation of apoptotic process; IDA:UniProtKB
GO:2001234; P:negative regulation of apoptotic signaling pathway; IEA:Ensembl
GO:0050771; P:negative regulation of axonogenesis; IEA:Ensembl
GO:0007175; P:negative regulation of epidermal growth factor-activated receptor activity; IEA:Ensembl
GO:0043524; P:negative regulation of neuron apoptotic process; IEA:Ensembl
GO:2000059; P:negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process; IEA:Ensembl
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IEA:Ensembl
GO:0051444; P:negative regulation of ubiquitin-protein transferase activity; IEA:Ensembl
GO:0051402; P:neuron apoptotic process; IEA:Ensembl
GO:0048666; P:neuron development; IEA:Ensembl
GO:0001764; P:neuron migration; IEA:Ensembl
GO:0007220; P:Notch receptor processing; TAS:HGNC
GO:0007219; P:Notch signaling pathway; IEA:UniProtKB-KW
GO:0043065; P:positive regulation of apoptotic process; IEA:Ensembl
GO:0043085; P:positive regulation of catalytic activity; IDA:HGNC
GO:0050820; P:positive regulation of coagulation; IEA:Ensembl
GO:0043406; P:positive regulation of MAP kinase activity; IEA:Ensembl
GO:0032436; P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process; IEA:Ensembl
GO:0001921; P:positive regulation of receptor recycling; IEA:Ensembl
GO:0009791; P:post-embryonic development; IEA:Ensembl
GO:0006486; P:protein glycosylation; IEA:Ensembl
GO:0016485; P:protein processing; IDA:HGNC
GO:0015031; P:protein transport; IEA:Ensembl
GO:0042325; P:regulation of phosphorylation; IDA:UniProtKB
GO:0043393; P:regulation of protein binding; IEA:Ensembl
GO:0060075; P:regulation of resting membrane potential; IEA:Ensembl
GO:0048167; P:regulation of synaptic plasticity; IEA:Ensembl
GO:0051966; P:regulation of synaptic transmission, glutamatergic; IEA:Ensembl
GO:0006979; P:response to oxidative stress; IEA:Ensembl
GO:0016337; P:single organismal cell-cell adhesion; IMP:MGI
GO:0048705; P:skeletal system morphogenesis; IEA:Ensembl
GO:0043589; P:skin morphogenesis; IEA:Ensembl
GO:0051563; P:smooth endoplasmic reticulum calcium ion homeostasis; IBA:RefGenome
GO:0001756; P:somitogenesis; IEA:Ensembl
GO:0016080; P:synaptic vesicle targeting; IEA:Ensembl
GO:0002286; P:T cell activation involved in immune response; IEA:Ensembl
GO:0050852; P:T cell receptor signaling pathway; IEA:Ensembl
GO:0048538; P:thymus development; IEA:Ensembl
Interpro
InterPro; IPR002031; Pept_A22A_PS1
InterPro; IPR001108; Peptidase_A22A
InterPro; IPR006639; Preselin/SPP
Pfam
Pfam; PF01080; Presenilin;
SMART
SMART; SM00730; PSN;
PROSITE
PRINTS
PRINTS; PR01072; PRESENILIN;
PRINTS; PR01073; PRESENILIN1;