| Tag |
Content |
LipidDB ID |
LipidDB-559292-00180 |
Entry Name |
|
UniProt Accession |
|
Theoretical PI |
7.88 |
Molecular Weight |
4228.85 |
Genbank Protein ID |
|
Genbank Nucleotide ID |
|
Protein Name |
Mating hormone A-factor 2 |
Protein Synonyms/Alias |
|
Gene Name |
MFA2 |
Gene Synonyms/Alias |
YNL145W; N1204; N1787; |
Created Date |
01-FEB-1994 |
| Lipid Modification Sites |
|---|
| Position |
Sequence Form |
Peptide |
References |
Modification Type |
35 | Canonical | GLFWDPACVIA**** | [1] | S-Farnesylation |
|
Organism |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
NCBI Taxa ID |
559292 |
Reference |
[1] Anderegg RJ, Betz R, Carr SA, Crabb JW, Duntze W. Structure of Saccharomycescerevisiae mating hormone a-factor. Identification of S-farnesyl cysteine as astructural component. J Biol Chem. 1988 Dec 5;263(34):18236-40.[ PMID:3056940]
|
Functional Description |
The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A. |
Sequence Annotation |
Modified residue: 35 35 Cysteine methyl ester.
|
Protein Length |
38 AA. |
Protein Sequence
(Canonical) |
MQPITTASTQ ATQKDKSSEK KDNYIIKGLF WDPACVIA 38
|
FASTA
(Canonical) |
>LipidDB-559292-00180|P34166
MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA
|
Gene Ontology |
GO:0005576; C:extracellular region; IDA:SGD GO:0005886; C:plasma membrane; IEA:UniProtKB-KW GO:0000772; F:mating pheromone activity; IMP:SGD GO:0000750; P:pheromone-dependent signal transduction involved in conjugation with cellular fusion; IMP:SGD |
Interpro |
|
Pfam |
|
SMART |
|
PROSITE |
|
PRINTS |
|