Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10116-00577
Entry Name
UniProt Accession
Theoretical PI
4.62
Molecular Weight
21800.48
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Calcium and integrin-binding protein 1
Protein Synonyms/Alias
CIB; Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP;
Gene Name
Cib1
Gene Synonyms/Alias
Cib; Kip; Prkdcip;
Created Date
11-JAN-2001
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
2
Canonical
******MGGSGSRLS
[1]
N-Myristoylation
Organism
Rattus norvegicus (Rat)
NCBI Taxa ID
10116
Reference
[1] Hennigs JK, Burhenne N, Stähler F, Winnig M, Walter B, Meyerhof W, Schmale H. Sweet taste receptor interacting protein CIB1 is a general inhibitor ofInsP3-dependent Ca2+ release in vivo. J Neurochem. 2008 Sep;106(5):2249-62. doi: 10.1111/j.1471-4159.2008.05563.x.[PMID:18627437]
Functional Description
Calcium-binding protein that plays a role in the regulation of numerous cellular processes, such as cell differentiation, cell division, cell proliferation, cell migration, thrombosis, angiogenesis, cardiac hypertrophy and apoptosis. Involved in bone marrow megakaryocyte differentiation by negatively regulating thrombopoietin-mediated signaling pathway. Participates in the endomitotic cell cycle of megakaryocyte, a form of mitosis in which both karyokinesis and cytokinesis are interrupted. Plays a role in integrin signaling by negatively regulating alpha-IIb/beta3 activation in thrombin- stimulated megakaryocytes preventing platelet aggregation. Up- regulates PTK2/FAK1 activity, and is also needed for the recruitment of PTK2/FAK1 to focal adhesions; it thus appears to play an important role in focal adhesion formation. Positively regulates cell migration on fibronectin in a CDC42-dependent manner, the effect being negatively regulated by PAK1. Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. Down-regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Involved in sphingosine kinase SPHK1 translocation to the plasma membrane in a N- myristoylation-dependent manner preventing TNF-alpha-induced apoptosis. Regulates serine/threonine-protein kinase PLK3 activity for proper completion of cell division progression. Plays a role in microtubule (MT) dynamics during neuronal development; disrupts the MT depolymerization activity of STMN2 attenuating NGF-induced neurite outgrowth and the MT reorganization at the edge of lamellipodia. Promotes cardiomyocyte hypertrophy via activation of the calcineurin/NFAT signaling pathway. Stimulates calcineurin PPP3R1 activity by mediating its anchoring to the sarcolemma. In ischemia-induced (pathological or adaptive) angiogenesis, stimulates endothelial cell proliferation, migration and microvessel formation by activating the PAK1 and ERK1/ERK2 signaling pathway. Promotes also cancer cell survival and proliferation. May regulate cell cycle and differentiation of spermatogenic germ cells, and/or differentiation of supporting Sertoli cells (By similarity).
Sequence Annotation
Domain: 103 138 EF-hand 1.
Domain: 148 183 EF-hand 2.
Modified residue: 78 78 Phosphoserine.
Protein Length
191 AA.
Protein Sequence
(Canonical)
MGGSGSRLSK ELLAEYQDLT FLTKQEILLA HRRFCELLPP EHRTVEESLH TRVSFEQILS  60
LPELKANPFK ERICMVFSTS PTRDSLSFED FLDLLSVFSD TATPDIKSHY AFRIFDFDDD  120
GTLDREDLSR LVNCLTGEGE DTRLSASEMK QLIDNILEES DIDRDGTINL SEFQHVISRS  180
PDFASSFKIV L                                                       191
FASTA
(Canonical)
>LipidDB-10116-00577|Q9R010
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILS
LPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLDREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Gene Ontology
GO:0071944; C:cell periphery; ISS:UniProtKB
GO:0005813; C:centrosome; ISS:UniProtKB
GO:0005737; C:cytoplasm; ISS:HGNC
GO:0005783; C:endoplasmic reticulum; ISS:HGNC
GO:0070062; C:extracellular vesicular exosome; IEA:Ensembl
GO:0032433; C:filopodium tip; ISS:UniProtKB
GO:0030426; C:growth cone; ISS:UniProtKB
GO:0030027; C:lamellipodium; ISS:UniProtKB
GO:0016020; C:membrane; ISS:HGNC
GO:0043005; C:neuron projection; ISS:UniProtKB
GO:0043025; C:neuronal cell body; ISS:UniProtKB
GO:0005654; C:nucleoplasm; ISS:HGNC
GO:0005634; C:nucleus; ISS:UniProtKB
GO:0048471; C:perinuclear region of cytoplasm; ISS:UniProtKB
GO:0005886; C:plasma membrane; ISS:UniProtKB
GO:0042383; C:sarcolemma; IEA:Ensembl
GO:0005509; F:calcium ion binding; ISS:HGNC
GO:0001525; P:angiogenesis; IEA:UniProtKB-KW
GO:0006915; P:apoptotic process; ISS:HGNC
GO:0007155; P:cell adhesion; IEA:UniProtKB-KW
GO:0051301; P:cell division; IEA:UniProtKB-KW
GO:0006974; P:cellular response to DNA damage stimulus; ISS:HGNC
GO:0071363; P:cellular response to growth factor stimulus; ISS:UniProtKB
GO:1990090; P:cellular response to nerve growth factor stimulus; ISS:UniProtKB
GO:0071356; P:cellular response to tumor necrosis factor; ISS:UniProtKB
GO:0031122; P:cytoplasmic microtubule organization; ISS:UniProtKB
GO:0007113; P:endomitotic cell cycle; ISS:UniProtKB
GO:0043066; P:negative regulation of apoptotic process; ISS:UniProtKB
GO:0008285; P:negative regulation of cell proliferation; ISS:UniProtKB
GO:0045653; P:negative regulation of megakaryocyte differentiation; ISS:UniProtKB
GO:0007026; P:negative regulation of microtubule depolymerization; ISS:UniProtKB
GO:0010977; P:negative regulation of neuron projection development; ISS:UniProtKB
GO:0051898; P:negative regulation of protein kinase B signaling; ISS:UniProtKB
GO:0001933; P:negative regulation of protein phosphorylation; ISS:UniProtKB
GO:0030220; P:platelet formation; ISS:UniProtKB
GO:0070886; P:positive regulation of calcineurin-NFAT signaling cascade; IMP:BHF-UCL
GO:0033630; P:positive regulation of cell adhesion mediated by integrin; ISS:UniProtKB
GO:0030307; P:positive regulation of cell growth; ISS:UniProtKB
GO:0030335; P:positive regulation of cell migration; ISS:UniProtKB
GO:0090050; P:positive regulation of cell migration involved in sprouting angiogenesis; ISS:UniProtKB
GO:0008284; P:positive regulation of cell proliferation; ISS:UniProtKB
GO:0001954; P:positive regulation of cell-matrix adhesion; ISS:UniProtKB
GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; ISS:UniProtKB
GO:0090004; P:positive regulation of establishment of protein localization to plasma membrane; IEA:Ensembl
GO:1901313; P:positive regulation of gene expression involved in extracellular matrix organization; ISS:UniProtKB
GO:2000256; P:positive regulation of male germ cell proliferation; ISS:UniProtKB
GO:0048554; P:positive regulation of metalloenzyme activity; ISS:UniProtKB
GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; ISS:UniProtKB
GO:0001934; P:positive regulation of protein phosphorylation; ISS:UniProtKB
GO:0071902; P:positive regulation of protein serine/threonine kinase activity; ISS:UniProtKB
GO:0090314; P:positive regulation of protein targeting to membrane; ISS:UniProtKB
GO:1900026; P:positive regulation of substrate adhesion-dependent cell spreading; ISS:UniProtKB
GO:0051302; P:regulation of cell division; ISS:UniProtKB
GO:0042127; P:regulation of cell proliferation; ISS:UniProtKB
GO:0002931; P:response to ischemia; ISS:UniProtKB
GO:0007286; P:spermatid development; ISS:UniProtKB
GO:0038163; P:thrombopoietin-mediated signaling pathway; ISS:UniProtKB
Interpro
InterPro; IPR011992; EF-hand-dom_pair
InterPro; IPR018247; EF_Hand_1_Ca_BS
InterPro; IPR002048; EF_hand_dom
Pfam
Pfam; PF13499; EF-hand_7;
SMART
SMART; SM00054; EFh;
PROSITE
PROSITE; PS00018; EF_HAND_1;
PROSITE; PS50222; EF_HAND_2;
PRINTS