Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10090-01051
Entry Name
UniProt Accession
Theoretical PI
5.83
Molecular Weight
21782.16
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Transforming protein RhoA
Protein Synonyms/Alias
Gene Name
Rhoa
Gene Synonyms/Alias
Arha; Arha2;
Created Date
27-APR-2001
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
190
Canonical
RGKKKSGCLIL****
[1]
S-Geranylgeranylation
Organism
Mus musculus (Mouse)
NCBI Taxa ID
10090
Reference
[1] Ohsawa M, Mutoh J, Hisa H. Mevalonate sensitizes the nociceptive transmission in the mouse spinal cord. Pain. 2008 Feb;134(3):285-92. Epub 2007 Aug 30.[PMID:17764839]
Functional Description
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Required for the apical junction formation of keratinocyte cell-cell adhesion.
Sequence Annotation
Nucleotide-binding: 12 19 GTP.
Nucleotide-binding: 59 63 GTP.
Nucleotide-binding: 117 120 GTP.
Motif: 34 42 Effector region.
Modified residue: 188 188 Phosphoserine; by PKG/PRKG1.
Modified residue: 190 190 Cysteine methyl ester.
Protein Length
193 AA.
Protein Sequence
(Canonical)
MAAIRKKLVI VGDGACGKTC LLIVFSKDQF PEVYVPTVFE NYVADIEVDG KQVELALWDT  60
AGQEDYDRLR PLSYPDTDVI LMCFSIDSPD SLENIPEKWT PEVKHFCPNV PIILVGNKKD  120
LRNDEHTRRE LAKMKQEPVK PEEGRDMANR IGAFGYMECS AKTKDGVREV FEMATRAALQ  180
ARRGKKKSGC LIL                                                     193
FASTA
(Canonical)
>LipidDB-10090-01051|Q9QUI0
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
Gene Ontology
GO:0043296; C:apical junction complex; IEA:Ensembl
GO:0030424; C:axon; IEA:Ensembl
GO:0005938; C:cell cortex; ISS:UniProtKB
GO:0005856; C:cytoskeleton; IEA:UniProtKB-KW
GO:0005829; C:cytosol; IDA:MGI
GO:0070062; C:extracellular vesicular exosome; IEA:Ensembl
GO:0030027; C:lamellipodium; IDA:UniProtKB
GO:0005739; C:mitochondrion; IDA:MGI
GO:0005634; C:nucleus; IDA:MGI
GO:0005886; C:plasma membrane; IDA:MGI
GO:0032587; C:ruffle membrane; IDA:MGI
GO:0019003; F:GDP binding; IEA:Ensembl
GO:0005525; F:GTP binding; IEA:UniProtKB-KW
GO:0003924; F:GTPase activity; IDA:MGI
GO:0030036; P:actin cytoskeleton organization; IDA:MGI
GO:0030521; P:androgen receptor signaling pathway; IDA:MGI
GO:0043297; P:apical junction assembly; IDA:UniProtKB
GO:0007155; P:cell adhesion; IMP:MGI
GO:0030154; P:cell differentiation; IDA:MGI
GO:0000902; P:cell morphogenesis; IGI:MGI
GO:0007160; P:cell-matrix adhesion; IDA:MGI
GO:0021795; P:cerebral cortex cell migration; IMP:MGI
GO:0036089; P:cleavage furrow formation; ISS:UniProtKB
GO:0007010; P:cytoskeleton organization; IMP:MGI
GO:0021861; P:forebrain radial glial cell differentiation; IMP:MGI
GO:0007229; P:integrin-mediated signaling pathway; TAS:MGI
GO:0043124; P:negative regulation of I-kappaB kinase/NF-kappaB signaling; IEA:Ensembl
GO:0033144; P:negative regulation of intracellular steroid hormone receptor signaling pathway; IDA:MGI
GO:0043524; P:negative regulation of neuron apoptotic process; IMP:MGI
GO:0045665; P:negative regulation of neuron differentiation; IEA:Ensembl
GO:0048812; P:neuron projection morphogenesis; IEA:Ensembl
GO:0043931; P:ossification involved in bone maturation; IMP:BHF-UCL
GO:0030838; P:positive regulation of actin filament polymerization; IEA:Ensembl
GO:0045785; P:positive regulation of cell adhesion; IEA:Ensembl
GO:0030307; P:positive regulation of cell growth; IEA:Ensembl
GO:0030335; P:positive regulation of cell migration; IEA:Ensembl
GO:0043280; P:positive regulation of cysteine-type endopeptidase activity involved in apoptotic process; IEA:Ensembl
GO:0032467; P:positive regulation of cytokinesis; ISS:UniProtKB
GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; ISS:UniProtKB
GO:0043525; P:positive regulation of neuron apoptotic process; IEA:Ensembl
GO:0045666; P:positive regulation of neuron differentiation; ISO:MGI
GO:0071803; P:positive regulation of podosome assembly; IGI:MGI
GO:0045987; P:positive regulation of smooth muscle contraction; IEA:Ensembl
GO:0051496; P:positive regulation of stress fiber assembly; ISO:MGI
GO:0045727; P:positive regulation of translation; IEA:Ensembl
GO:0045907; P:positive regulation of vasoconstriction; IEA:Ensembl
GO:0051924; P:regulation of calcium ion transport; IEA:Ensembl
GO:0030334; P:regulation of cell migration; ISS:UniProtKB
GO:0050773; P:regulation of dendrite development; IEA:Ensembl
GO:2000177; P:regulation of neural precursor cell proliferation; IMP:MGI
GO:0033688; P:regulation of osteoblast proliferation; IMP:BHF-UCL
GO:0006357; P:regulation of transcription from RNA polymerase II promoter; IDA:MGI
GO:0043200; P:response to amino acid; IEA:Ensembl
GO:0042493; P:response to drug; IEA:Ensembl
GO:0045471; P:response to ethanol; IEA:Ensembl
GO:0051384; P:response to glucocorticoid; IEA:Ensembl
GO:0009749; P:response to glucose; IEA:Ensembl
GO:0001666; P:response to hypoxia; IEA:Ensembl
GO:0009612; P:response to mechanical stimulus; IEA:Ensembl
GO:0007266; P:Rho protein signal transduction; TAS:MGI
GO:0007519; P:skeletal muscle tissue development; IDA:MGI
GO:0090307; P:spindle assembly involved in mitosis; IEA:Ensembl
GO:0043149; P:stress fiber assembly; IDA:MGI
GO:0031098; P:stress-activated protein kinase signaling cascade; IEA:Ensembl
GO:0021762; P:substantia nigra development; IEA:Ensembl
GO:0061383; P:trabecula morphogenesis; IMP:BHF-UCL
Interpro
InterPro; IPR027417; P-loop_NTPase
InterPro; IPR005225; Small_GTP-bd_dom
InterPro; IPR001806; Small_GTPase
InterPro; IPR003578; Small_GTPase_Rho
Pfam
Pfam; PF00071; Ras;
SMART
SMART; SM00174; RHO;
PROSITE
PROSITE; PS51420; RHO;
PRINTS
PRINTS; PR00449; RASTRNSFRMNG;