Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10090-00970
Entry Name
UniProt Accession
Theoretical PI
5.23
Molecular Weight
52639.83
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Presenilin-1 CTF12
Protein Synonyms/Alias
PS-1; 3.4.23.-; Protein S182; PS1-CTF12;
Gene Name
Psen1
Gene Synonyms/Alias
Ad3h; Psnl1;
Created Date
01-OCT-1996
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
263
Canonical
YDLVAVLCPKGPLRM
[1]
S-Palmitoylation
Organism
Mus musculus (Mouse)
NCBI Taxa ID
10090
Reference
[1] Predicted from GPS-Lipid
Functional Description
Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. Stimulates cell-cell adhesion though its association with the E-cadherin/catenin complex. Under conditions of apoptosis or calcium influx, cleaves E-cadherin promoting the disassembly of the E-cadherin/catenin complex and increasing the pool of cytoplasmic beta-catenin, thus negatively regulating Wnt signaling. May also play a role in hematopoiesis (By similarity).
Sequence Annotation
Topological domain: 1 82 Cytoplasmic.
Transmembrane: 83 103 Helical.
Topological domain: 104 132 Lumenal.
Transmembrane: 133 153 Helical.
Topological domain: 154 160 Cytoplasmic.
Transmembrane: 161 181 Helical.
Topological domain: 182 194 Lumenal.
Transmembrane: 195 215 Helical.
Topological domain: 216 220 Cytoplasmic.
Transmembrane: 221 241 Helical.
Topological domain: 242 243 Lumenal.
Transmembrane: 244 264 Helical.
Topological domain: 265 380 Cytoplasmic.
Transmembrane: 381 401 Helical.
Topological domain: 402 407 Lumenal.
Transmembrane: 408 428 Helical.
Topological domain: 429 432 Cytoplasmic.
Topological domain: 454 467 Cytoplasmic.
Region: 322 450 Required for interaction with CTNNB1.
Region: 372 399 Required for interaction with CTNND2.
Region: 464 467 Interaction with MTCH1.
Motif: 433 435 PAL.
Active site: 257 257
Active site: 385 385
Functional site: 291 292 Cleavage; alternate.
Functional site: 292 293 Cleavage; alternate.
Functional site: 298 299 Cleavage.
Functional site: 345 346 Cleavage; by caspase.
Modified residue: 329 329 Phosphoserine.
Modified residue: 346 346 Phosphoserine; by PKC.
Modified residue: 367 367 Phosphoserine.
Modified residue: 370 370 Phosphothreonine.
Modified residue: 371 371 Phosphoserine.
Protein Length
467 AA.
Protein Sequence
(Canonical)
MTEIPAPLSY FQNAQMSEDS HSSSAIRSQN DSQERQQQHD RQRLDNPEPI SNGRPQSNSR  60
QVVEQDEEED EELTLKYGAK HVIMLFVPVT LCMVVVVATI KSVSFYTRKD GQLIYTPFTE  120
DTETVGQRAL HSILNAAIMI SVIVIMTILL VVLYKYRCYK VIHAWLIISS LLLLFFFSFI  180
YLGEVFKTYN VAVDYVTVAL LIWNFGVVGM IAIHWKGPLR LQQAYLIMIS ALMALVFIKY  240
LPEWTAWLIL AVISVYDLVA VLCPKGPLRM LVETAQERNE TLFPALIYSS TMVWLVNMAE  300
GDPEAQRRVP KNPKYNTQRA ERETQDSGSG NDDGGFSEEW EAQRDSHLGP HRSTPESRAA  360
VQELSGSILT SEDPEERGVK LGLGDFIFYS VLVGKASATA SGDWNTTIAC FVAILIGLCL  420
TLLLLAIFKK ALPALPISIT FGLVFYFATD YLVQPFMDQL AFHQFYI                467
FASTA
(Canonical)
>LipidDB-10090-00970|P49769
MTEIPAPLSYFQNAQMSEDSHSSSAIRSQNDSQERQQQHDRQRLDNPEPISNGRPQSNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVIMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYVTVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVPKNPKYNTQRAERETQDSGSGNDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
Gene Ontology
GO:0016324; C:apical plasma membrane; IBA:RefGenome
GO:0030424; C:axon; IDA:MGI
GO:0005938; C:cell cortex; IBA:RefGenome
GO:0009986; C:cell surface; IBA:RefGenome
GO:0005813; C:centrosome; IEA:Ensembl
GO:0035253; C:ciliary rootlet; IDA:MGI
GO:0031410; C:cytoplasmic vesicle; IDA:MGI
GO:0030425; C:dendrite; IDA:MGI
GO:0043198; C:dendritic shaft; IDA:MGI
GO:0005783; C:endoplasmic reticulum; ISS:UniProtKB
GO:0070765; C:gamma-secretase complex; IEA:Ensembl
GO:0005794; C:Golgi apparatus; ISS:UniProtKB
GO:0030426; C:growth cone; IDA:MGI
GO:0005887; C:integral component of plasma membrane; ISS:UniProtKB
GO:0005622; C:intracellular; IDA:MGI
GO:0000776; C:kinetochore; IEA:Ensembl
GO:0005765; C:lysosomal membrane; IBA:RefGenome
GO:0016020; C:membrane; IDA:MGI
GO:0045121; C:membrane raft; IBA:RefGenome
GO:0043227; C:membrane-bounded organelle; IDA:MGI
GO:0005743; C:mitochondrial inner membrane; IBA:RefGenome
GO:0005739; C:mitochondrion; ISS:UniProtKB
GO:0031594; C:neuromuscular junction; IBA:RefGenome
GO:0043025; C:neuronal cell body; IDA:MGI
GO:0005640; C:nuclear outer membrane; IEA:Ensembl
GO:0005634; C:nucleus; IDA:MGI
GO:0048471; C:perinuclear region of cytoplasm; IBA:RefGenome
GO:0005886; C:plasma membrane; IDA:MGI
GO:0005791; C:rough endoplasmic reticulum; IEA:Ensembl
GO:0005790; C:smooth endoplasmic reticulum; IEA:Ensembl
GO:0030018; C:Z disc; IBA:RefGenome
GO:0004190; F:aspartic-type endopeptidase activity; IEA:InterPro
GO:0008013; F:beta-catenin binding; IBA:RefGenome
GO:0045296; F:cadherin binding; IPI:MGI
GO:0005262; F:calcium channel activity; IEA:Ensembl
GO:0004175; F:endopeptidase activity; IMP:MGI
GO:0000186; P:activation of MAPKK activity; IMP:MGI
GO:0042987; P:amyloid precursor protein catabolic process; IMP:MGI
GO:0042640; P:anagen; IGI:MGI
GO:0000045; P:autophagic vacuole assembly; IMP:MGI
GO:0006914; P:autophagy; IMP:MGI
GO:0034205; P:beta-amyloid formation; IMP:MGI
GO:0050435; P:beta-amyloid metabolic process; IMP:MGI
GO:0001568; P:blood vessel development; IMP:MGI
GO:0007420; P:brain development; IMP:MGI
GO:0048854; P:brain morphogenesis; IGI:MGI
GO:0021870; P:Cajal-Retzius cell differentiation; IMP:MGI
GO:0006816; P:calcium ion transport; IBA:RefGenome
GO:0060070; P:canonical Wnt signaling pathway; IBA:RefGenome
GO:0001708; P:cell fate specification; IGI:MGI
GO:0006874; P:cellular calcium ion homeostasis; IMP:MGI
GO:0044267; P:cellular protein metabolic process; IDA:MGI
GO:0006974; P:cellular response to DNA damage stimulus; IMP:MGI
GO:0021795; P:cerebral cortex cell migration; IMP:MGI
GO:0021987; P:cerebral cortex development; IMP:MGI
GO:0015871; P:choline transport; IMP:MGI
GO:0021904; P:dorsal/ventral neural tube patterning; IGI:MGI
GO:0030326; P:embryonic limb morphogenesis; IGI:MGI
GO:0032469; P:endoplasmic reticulum calcium ion homeostasis; IMP:MGI
GO:0050673; P:epithelial cell proliferation; IGI:MGI
GO:0030900; P:forebrain development; IGI:MGI
GO:0007507; P:heart development; IMP:MGI
GO:0001947; P:heart looping; IGI:MGI
GO:0002244; P:hematopoietic progenitor cell differentiation; IGI:MGI
GO:0035556; P:intracellular signal transduction; IEA:InterPro
GO:0015813; P:L-glutamate transport; IMP:MGI
GO:0007611; P:learning or memory; IGI:MGI
GO:0040011; P:locomotion; IGI:MGI
GO:0006509; P:membrane protein ectodomain proteolysis; ISS:UniProtKB
GO:0007613; P:memory; IMP:MGI
GO:0006839; P:mitochondrial transport; IMP:MGI
GO:0043011; P:myeloid dendritic cell differentiation; IMP:MGI
GO:0002573; P:myeloid leukocyte differentiation; IGI:MGI
GO:0043066; P:negative regulation of apoptotic process; IDA:MGI
GO:2001234; P:negative regulation of apoptotic signaling pathway; IGI:MGI
GO:0050771; P:negative regulation of axonogenesis; IMP:MGI
GO:0007175; P:negative regulation of epidermal growth factor-activated receptor activity; IMP:BHF-UCL
GO:0043524; P:negative regulation of neuron apoptotic process; IEA:Ensembl
GO:0006469; P:negative regulation of protein kinase activity; IMP:MGI
GO:0001933; P:negative regulation of protein phosphorylation; IGI:MGI
GO:2000059; P:negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process; IMP:BHF-UCL
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IMP:BHF-UCL
GO:0051444; P:negative regulation of ubiquitin-protein transferase activity; IMP:BHF-UCL
GO:0022008; P:neurogenesis; IMP:MGI
GO:0051402; P:neuron apoptotic process; IGI:MGI
GO:0048666; P:neuron development; IMP:MGI
GO:0030182; P:neuron differentiation; IMP:MGI
GO:0001764; P:neuron migration; IMP:MGI
GO:0007220; P:Notch receptor processing; IMP:MGI
GO:0007219; P:Notch signaling pathway; IMP:MGI
GO:0043065; P:positive regulation of apoptotic process; IGI:MGI
GO:0043085; P:positive regulation of catalytic activity; ISS:UniProtKB
GO:0050820; P:positive regulation of coagulation; IMP:MGI
GO:0043406; P:positive regulation of MAP kinase activity; IMP:MGI
GO:0032436; P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process; IMP:BHF-UCL
GO:0045860; P:positive regulation of protein kinase activity; IDA:MGI
GO:0001934; P:positive regulation of protein phosphorylation; IMP:MGI
GO:0001921; P:positive regulation of receptor recycling; IMP:BHF-UCL
GO:0009791; P:post-embryonic development; IMP:MGI
GO:0006486; P:protein glycosylation; IMP:MGI
GO:0051604; P:protein maturation; IGI:MGI
GO:0016485; P:protein processing; ISS:UniProtKB
GO:0015031; P:protein transport; IGI:MGI
GO:0007176; P:regulation of epidermal growth factor-activated receptor activity; IGI:MGI
GO:0043393; P:regulation of protein binding; IGI:MGI
GO:0060075; P:regulation of resting membrane potential; IMP:MGI
GO:0048167; P:regulation of synaptic plasticity; IMP:MGI
GO:0051966; P:regulation of synaptic transmission, glutamatergic; IMP:MGI
GO:0006979; P:response to oxidative stress; IMP:MGI
GO:0035282; P:segmentation; IMP:MGI
GO:0016337; P:single organismal cell-cell adhesion; ISO:MGI
GO:0048705; P:skeletal system morphogenesis; IMP:MGI
GO:0043589; P:skin morphogenesis; IMP:BHF-UCL
GO:0051563; P:smooth endoplasmic reticulum calcium ion homeostasis; IGI:MGI
GO:0001756; P:somitogenesis; IMP:MGI
GO:0016080; P:synaptic vesicle targeting; IMP:MGI
GO:0002286; P:T cell activation involved in immune response; IGI:MGI
GO:0050852; P:T cell receptor signaling pathway; IGI:MGI
GO:0048538; P:thymus development; IMP:MGI
Interpro
InterPro; IPR002031; Pept_A22A_PS1
InterPro; IPR001108; Peptidase_A22A
InterPro; IPR006639; Preselin/SPP
Pfam
Pfam; PF01080; Presenilin;
SMART
SMART; SM00730; PSN;
PROSITE
PRINTS
PRINTS; PR01072; PRESENILIN;
PRINTS; PR01073; PRESENILIN1;