Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10090-00599
Entry Name
UniProt Accession
Theoretical PI
8.83
Molecular Weight
42309.42
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Protein Wnt-5a
Protein Synonyms/Alias
Gene Name
Wnt5a
Gene Synonyms/Alias
Wnt-5a;
Created Date
01-AUG-1991
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
104
Canonical
AKTGIKECQYQFRHR
[1]
S-Palmitoylation
Organism
Mus musculus (Mouse)
NCBI Taxa ID
10090
Reference
[1] Kurayoshi M, Yamamoto H, Izumi S, Kikuchi A. Post-translational palmitoylationand glycosylation of Wnt-5a are necessary for its signalling. Biochem J. 2007 Mar15;402(3):515-23.[PMID:17117926]
Functional Description
Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes.
Sequence Annotation
Protein Length
380 AA.
Protein Sequence
(Canonical)
MKKPIGILSP GVALGTAGGA MSSKFFLMAL ATFFSFAQVV IEANSWWSLG MNNPVQMSEV  60
YIIGAQPLCS QLAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN  120
TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG  180
GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC  240
HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV  300
YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH  360
WCCYVKCKKC TEIVDQFVCK                                              380
FASTA
(Canonical)
>LipidDB-10090-00599|P22725
MKKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
Gene Ontology
GO:0009986; C:cell surface; IDA:BHF-UCL
GO:0005788; C:endoplasmic reticulum lumen; TAS:Reactome
GO:0031012; C:extracellular matrix; IDA:MGI
GO:0005576; C:extracellular region; TAS:Reactome
GO:0005615; C:extracellular space; IBA:RefGenome
GO:0005578; C:proteinaceous extracellular matrix; IEA:UniProtKB-KW
GO:0005125; F:cytokine activity; IDA:BHF-UCL
GO:0005109; F:frizzled binding; IPI:BHF-UCL
GO:0005110; F:frizzled-2 binding; IDA:MGI
GO:0019904; F:protein domain specific binding; IPI:UniProtKB
GO:0005102; F:receptor binding; IPI:MGI
GO:0003700; F:sequence-specific DNA binding transcription factor activity; ISS:UniProtKB
GO:0044212; F:transcription regulatory region DNA binding; IEA:Ensembl
GO:0007257; P:activation of JUN kinase activity; IEA:Ensembl
GO:0032148; P:activation of protein kinase B activity; IEA:Ensembl
GO:0001667; P:ameboidal cell migration; IMP:MGI
GO:0008595; P:anterior/posterior axis specification, embryo; IDA:BHF-UCL
GO:0009952; P:anterior/posterior pattern specification; IMP:MGI
GO:0003401; P:axis elongation; IMP:MGI
GO:0007411; P:axon guidance; IDA:UniProtKB
GO:0060070; P:canonical Wnt signaling pathway; IDA:BHF-UCL
GO:0051216; P:cartilage development; IEA:UniProtKB-KW
GO:0045165; P:cell fate commitment; IBA:RefGenome
GO:0016477; P:cell migration; IMP:MGI
GO:0007267; P:cell-cell signaling; TAS:MGI
GO:0034613; P:cellular protein localization; IMP:MGI
GO:0071277; P:cellular response to calcium ion; IEA:Ensembl
GO:0071346; P:cellular response to interferon-gamma; IEA:Ensembl
GO:0071222; P:cellular response to lipopolysaccharide; IEA:Ensembl
GO:0071219; P:cellular response to molecule of bacterial origin; IDA:BHF-UCL
GO:0071560; P:cellular response to transforming growth factor beta stimulus; IEA:Ensembl
GO:0060067; P:cervix development; IMP:MGI
GO:0090103; P:cochlea morphogenesis; IMP:MGI
GO:0060026; P:convergent extension; IMP:MGI
GO:0060029; P:convergent extension involved in organogenesis; IGI:MGI
GO:0007368; P:determination of left/right symmetry; IMP:MGI
GO:0046546; P:development of primary male sexual characteristics; IMP:MGI
GO:0048546; P:digestive tract morphogenesis; IMP:MGI
GO:0071542; P:dopaminergic neuron differentiation; IMP:MGI
GO:0042733; P:embryonic digit morphogenesis; IMP:MGI
GO:0030326; P:embryonic limb morphogenesis; IMP:MGI
GO:0048706; P:embryonic skeletal system development; IEA:Ensembl
GO:0060750; P:epithelial cell proliferation involved in mammary gland duct elongation; IDA:MGI
GO:0001837; P:epithelial to mesenchymal transition; IEA:Ensembl
GO:0001736; P:establishment of planar polarity; IMP:MGI
GO:0060324; P:face development; IEA:Ensembl
GO:0001947; P:heart looping; IGI:MGI
GO:0071425; P:hematopoietic stem cell proliferation; IDA:MGI
GO:0007442; P:hindgut morphogenesis; IMP:MGI
GO:0048850; P:hypophysis morphogenesis; IMP:MGI
GO:0042472; P:inner ear morphogenesis; IDA:MGI
GO:0007254; P:JNK cascade; IDA:MGI
GO:0030216; P:keratinocyte differentiation; IEA:Ensembl
GO:0060599; P:lateral sprouting involved in mammary gland duct morphogenesis; IDA:MGI
GO:0035108; P:limb morphogenesis; IMP:MGI
GO:0030324; P:lung development; IMP:MGI
GO:0008584; P:male gonad development; IMP:MGI
GO:0060744; P:mammary gland branching involved in thelarche; IDA:MGI
GO:0060638; P:mesenchymal-epithelial cell signaling; IMP:MGI
GO:0007494; P:midgut development; IMP:MGI
GO:0002009; P:morphogenesis of an epithelium; IMP:MGI
GO:0050919; P:negative chemotaxis; IGI:MGI
GO:0043066; P:negative regulation of apoptotic process; IEA:Ensembl
GO:0048843; P:negative regulation of axon extension involved in axon guidance; IGI:MGI
GO:0030514; P:negative regulation of BMP signaling pathway; IMP:MGI
GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IDA:BHF-UCL
GO:0050680; P:negative regulation of epithelial cell proliferation; IDA:MGI
GO:0045599; P:negative regulation of fat cell differentiation; IEA:Ensembl
GO:0040037; P:negative regulation of fibroblast growth factor receptor signaling pathway; IMP:MGI
GO:0072201; P:negative regulation of mesenchymal cell proliferation; IEA:Ensembl
GO:0060686; P:negative regulation of prostatic bud formation; IMP:MGI
GO:0051964; P:negative regulation of synapse assembly; IDA:BHF-UCL
GO:0045892; P:negative regulation of transcription, DNA-templated; IEA:Ensembl
GO:0001843; P:neural tube closure; IGI:MGI
GO:0021915; P:neural tube development; IGI:MGI
GO:0048812; P:neuron projection morphogenesis; IDA:UniProtKB
GO:0038031; P:non-canonical Wnt signaling pathway via JNK cascade; IMP:BHF-UCL
GO:0021891; P:olfactory bulb interneuron development; IMP:UniProtKB
GO:0009887; P:organ morphogenesis; TAS:MGI
GO:0060021; P:palate development; IEA:Ensembl
GO:0003344; P:pericardium morphogenesis; IGI:MGI
GO:0061350; P:planar cell polarity pathway involved in cardiac muscle tissue morphogenesis; IMP:MGI
GO:0061349; P:planar cell polarity pathway involved in cardiac right atrium morphogenesis; IMP:MGI
GO:0090179; P:planar cell polarity pathway involved in neural tube closure; IMP:MGI
GO:0061347; P:planar cell polarity pathway involved in outflow tract morphogenesis; IMP:MGI
GO:0061354; P:planar cell polarity pathway involved in pericardium morphogenesis; IMP:MGI
GO:0061348; P:planar cell polarity pathway involved in ventricular septum morphogenesis; IMP:MGI
GO:0045766; P:positive regulation of angiogenesis; IEA:Ensembl
GO:0061036; P:positive regulation of cartilage development; IDA:MGI
GO:0008284; P:positive regulation of cell proliferation; IDA:MGI
GO:2000049; P:positive regulation of cell-cell adhesion mediated by cadherin; IDA:MGI
GO:0030825; P:positive regulation of cGMP metabolic process; IEA:Ensembl
GO:0045080; P:positive regulation of chemokine biosynthetic process; IEA:Ensembl
GO:0002741; P:positive regulation of cytokine secretion involved in immune response; IEA:Ensembl
GO:0010595; P:positive regulation of endothelial cell migration; IEA:Ensembl
GO:0001938; P:positive regulation of endothelial cell proliferation; IEA:Ensembl
GO:0050679; P:positive regulation of epithelial cell proliferation; IMP:MGI
GO:0048146; P:positive regulation of fibroblast proliferation; IEA:Ensembl
GO:0050729; P:positive regulation of inflammatory response; IEA:Ensembl
GO:0032729; P:positive regulation of interferon-gamma production; IMP:BHF-UCL
GO:0050718; P:positive regulation of interleukin-1 beta secretion; IDA:BHF-UCL
GO:0032755; P:positive regulation of interleukin-6 production; IDA:BHF-UCL
GO:2000484; P:positive regulation of interleukin-8 secretion; IDA:BHF-UCL
GO:0046330; P:positive regulation of JNK cascade; IMP:BHF-UCL
GO:0043507; P:positive regulation of JUN kinase activity; IDA:MGI
GO:0043032; P:positive regulation of macrophage activation; IEA:Ensembl
GO:0060907; P:positive regulation of macrophage cytokine production; IEA:Ensembl
GO:0045836; P:positive regulation of meiosis; IGI:MGI
GO:0002053; P:positive regulation of mesenchymal cell proliferation; IMP:MGI
GO:0010976; P:positive regulation of neuron projection development; IDA:UniProtKB
GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; IEA:Ensembl
GO:0045778; P:positive regulation of ossification; IEA:Ensembl
GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IGI:MGI
GO:0010800; P:positive regulation of peptidyl-threonine phosphorylation; IGI:MGI
GO:0045732; P:positive regulation of protein catabolic process; IEA:Ensembl
GO:0090037; P:positive regulation of protein kinase C signaling; IEA:Ensembl
GO:0001934; P:positive regulation of protein phosphorylation; IDA:MGI
GO:0010820; P:positive regulation of T cell chemotaxis; IEA:Ensembl
GO:0070245; P:positive regulation of thymocyte apoptotic process; IMP:MGI
GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IEA:Ensembl
GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:BHF-UCL
GO:0060340; P:positive regulation of type I interferon-mediated signaling pathway; IEA:Ensembl
GO:0036342; P:post-anal tail morphogenesis; IMP:MGI
GO:0090009; P:primitive streak formation; IGI:MGI
GO:0006468; P:protein phosphorylation; IGI:MGI
GO:0060762; P:regulation of branching involved in mammary gland duct morphogenesis; IDA:MGI
GO:0007165; P:signal transduction; TAS:MGI
GO:0001756; P:somitogenesis; IGI:MGI
GO:0060606; P:tube closure; IMP:MGI
GO:0003323; P:type B pancreatic cell development; IMP:MGI
GO:0060157; P:urinary bladder development; IMP:MGI
GO:0060065; P:uterus development; IMP:MGI
GO:0060068; P:vagina development; IMP:MGI
GO:0016055; P:Wnt signaling pathway; IGI:MGI
GO:0007223; P:Wnt signaling pathway, calcium modulating pathway; IDA:BHF-UCL
GO:0060071; P:Wnt signaling pathway, planar cell polarity pathway; IDA:MGI
GO:0042060; P:wound healing; IEA:Ensembl
Interpro
InterPro; IPR005817; Wnt
InterPro; IPR026538; Wnt5a
InterPro; IPR018161; Wnt_CS
Pfam
Pfam; PF00110; wnt;
SMART
SMART; SM00097; WNT1;
PROSITE
PROSITE; PS00246; WNT1;
PRINTS
PRINTS; PR01349; WNTPROTEIN;