Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10090-00371
Entry Name
UniProt Accession
Theoretical PI
5.64
Molecular Weight
20538.66
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Caveolin-1
Protein Synonyms/Alias
Gene Name
Cav1
Gene Synonyms/Alias
Cav;
Created Date
01-OCT-1996
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
133
Canonical
HIWAVVPCIKSFLIE
[1][2]
S-Palmitoylation
143
Canonical
SFLIEIQCISRVYSI
[1][2]
S-Palmitoylation
156
Canonical
SIYVHTFCDPLFEAI
[1][2]
S-Palmitoylation
Organism
Mus musculus (Mouse)
NCBI Taxa ID
10090
Reference
[1] Sotgia F, Razani B, Bonuccelli G, Schubert W, Battista M, Lee H, Capozza F,Schubert AL, Minetti C, Buckley JT, Lisanti MP. Intracellular retention ofglycosylphosphatidyl inositol-linked proteins in caveolin-deficient cells. MolCell Biol. 2002 Jun;22(11):3905-26.[PMID:11997523]
[2] Frank PG, Marcel YL, Connelly MA, Lublin DM, Franklin V, Williams DL, Lisanti MP. Stabilization of caveolin-1 by cellular cholesterol and scavenger receptorclass B type I. Biochemistry. 2002 Oct 1;41(39):11931-40.[PMID:12269838]
Functional Description
Involved in the costimulatory signal essential for T- cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar membranes. Interacts directly with G- protein alpha subunits and can functionally regulate their activity. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.
Sequence Annotation
Topological domain: 2 104 Cytoplasmic.
Topological domain: 126 178 Cytoplasmic.
Modified residue: 2 2 N-acetylserine.
Modified residue: 5 5 N6-acetyllysine.
Modified residue: 6 6 Phosphotyrosine.
Modified residue: 14 14 Phosphotyrosine; by ABL1 and INSR.
Modified residue: 25 25 Phosphotyrosine.
Modified residue: 42 42 Phosphotyrosine.
Protein Length
178 AA.
Protein Sequence
(Canonical)
MSGGKYVDSE GHLYTVPIRE QGNIYKPNNK AMADEVTEKQ VYDAHTKEID LVNRDPKHLN  60
DDVVKIDFED VIAEPEGTHS FDGIWKASFT TFTVTKYWFY RLLSTIFGIP MALIWGIYFA  120
ILSFLHIWAV VPCIKSFLIE IQCISRVYSI YVHTFCDPLF EAIGKIFSNI RISTQKEI    178
FASTA
(Canonical)
>LipidDB-10090-00371|P49817
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
Gene Ontology
GO:0002080; C:acrosomal membrane; IDA:MGI
GO:0016324; C:apical plasma membrane; IEA:Ensembl
GO:0016323; C:basolateral plasma membrane; IEA:Ensembl
GO:0005901; C:caveola; ISS:UniProtKB
GO:0005938; C:cell cortex; IDA:MGI
GO:0005929; C:cilium; IDA:MGI
GO:0031410; C:cytoplasmic vesicle; ISO:MGI
GO:0005783; C:endoplasmic reticulum; ISS:HGNC
GO:0005768; C:endosome; ISS:UniProtKB
GO:0005794; C:Golgi apparatus; IDA:MGI
GO:0000139; C:Golgi membrane; ISS:HGNC
GO:0016021; C:integral component of membrane; IDA:MGI
GO:0005887; C:integral component of plasma membrane; IDA:MGI
GO:0016020; C:membrane; IDA:MGI
GO:0045121; C:membrane raft; IDA:MGI
GO:0048471; C:perinuclear region of cytoplasm; IDA:MGI
GO:0005886; C:plasma membrane; IDA:MGI
GO:0043234; C:protein complex; IPI:MGI
GO:0016504; F:peptidase activator activity; IMP:MGI
GO:0005198; F:structural molecule activity; IEA:Ensembl
GO:0001525; P:angiogenesis; IGI:MGI
GO:0097190; P:apoptotic signaling pathway; IEA:Ensembl
GO:0055074; P:calcium ion homeostasis; IMP:MGI
GO:0006816; P:calcium ion transport; IMP:MGI
GO:0070836; P:caveola assembly; IMP:MGI
GO:0072584; P:caveolin-mediated endocytosis; IEA:Ensembl
GO:0006874; P:cellular calcium ion homeostasis; IMP:MGI
GO:0071455; P:cellular response to hyperoxia; IEA:Ensembl
GO:0009267; P:cellular response to starvation; IEA:Ensembl
GO:0042632; P:cholesterol homeostasis; IMP:MGI
GO:0051480; P:cytosolic calcium ion homeostasis; IEA:Ensembl
GO:0006897; P:endocytosis; TAS:MGI
GO:0000188; P:inactivation of MAPK activity; IMP:MGI
GO:0007595; P:lactation; IMP:MGI
GO:0019915; P:lipid storage; IMP:MGI
GO:0030879; P:mammary gland development; IMP:MGI
GO:0060056; P:mammary gland involution; IMP:MGI
GO:0000165; P:MAPK cascade; IMP:MGI
GO:0051899; P:membrane depolarization; IMP:MGI
GO:2000811; P:negative regulation of anoikis; IMP:UniProtKB
GO:0030514; P:negative regulation of BMP signaling pathway; IEA:Ensembl
GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IDA:UniProtKB
GO:0008285; P:negative regulation of cell proliferation; IMP:MGI
GO:0001960; P:negative regulation of cytokine-mediated signaling pathway; IMP:MGI
GO:0001937; P:negative regulation of endothelial cell proliferation; IMP:MGI
GO:0030857; P:negative regulation of epithelial cell differentiation; IMP:MGI
GO:0046426; P:negative regulation of JAK-STAT cascade; IDA:MGI
GO:0043407; P:negative regulation of MAP kinase activity; IMP:MGI
GO:0043409; P:negative regulation of MAPK cascade; IMP:MGI
GO:0045019; P:negative regulation of nitric oxide biosynthetic process; IMP:MGI
GO:0051001; P:negative regulation of nitric-oxide synthase activity; IMP:MGI
GO:0033137; P:negative regulation of peptidyl-serine phosphorylation; IEA:Ensembl
GO:0048550; P:negative regulation of pinocytosis; IEA:Ensembl
GO:0032091; P:negative regulation of protein binding; IEA:Ensembl
GO:0031397; P:negative regulation of protein ubiquitination; IMP:UniProtKB
GO:0009968; P:negative regulation of signal transduction; IDA:MGI
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:UniProtKB
GO:0042524; P:negative regulation of tyrosine phosphorylation of Stat5 protein; IDA:MGI
GO:0033484; P:nitric oxide homeostasis; IMP:MGI
GO:0010524; P:positive regulation of calcium ion transport into cytosol; IDA:BHF-UCL
GO:0090263; P:positive regulation of canonical Wnt signaling pathway; IEA:Ensembl
GO:2001238; P:positive regulation of extrinsic apoptotic signaling pathway; IEA:Ensembl
GO:2001244; P:positive regulation of intrinsic apoptotic signaling pathway; IEA:Ensembl
GO:0048554; P:positive regulation of metalloenzyme activity; IMP:MGI
GO:0010952; P:positive regulation of peptidase activity; IMP:GOC
GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IEA:Ensembl
GO:0045907; P:positive regulation of vasoconstriction; IMP:MGI
GO:0051260; P:protein homooligomerization; IDA:MGI
GO:0008104; P:protein localization; IMP:MGI
GO:0051259; P:protein oligomerization; IDA:MGI
GO:2000286; P:receptor internalization involved in canonical Wnt signaling pathway; IEA:Ensembl
GO:0030193; P:regulation of blood coagulation; IEA:Ensembl
GO:0019217; P:regulation of fatty acid metabolic process; IMP:MGI
GO:0052547; P:regulation of peptidase activity; IMP:MGI
GO:0006940; P:regulation of smooth muscle contraction; IMP:MGI
GO:0002026; P:regulation of the force of heart contraction; IMP:MGI
GO:0003057; P:regulation of the force of heart contraction by chemical signal; IGI:MGI
GO:0051592; P:response to calcium ion; IDA:BHF-UCL
GO:0043627; P:response to estrogen; IDA:MGI
GO:0001666; P:response to hypoxia; IMP:MGI
GO:0002931; P:response to ischemia; IMP:MGI
GO:0032570; P:response to progesterone; ISO:MGI
GO:0007519; P:skeletal muscle tissue development; IMP:MGI
GO:0031295; P:T cell costimulation; ISS:UniProtKB
GO:0006641; P:triglyceride metabolic process; IMP:MGI
GO:0001570; P:vasculogenesis; IMP:MGI
GO:0042310; P:vasoconstriction; IMP:MGI
GO:0016050; P:vesicle organization; IEA:Ensembl
Interpro
InterPro; IPR001612; Caveolin
InterPro; IPR015504; Caveolin_1
InterPro; IPR018361; Caveolin_CS
Pfam
Pfam; PF01146; Caveolin;
SMART
PROSITE
PROSITE; PS01210; CAVEOLIN;
PRINTS