Lipid Modification Database
Tag Content
LipidDB ID
LipidDB-10090-00224
Entry Name
UniProt Accession
Theoretical PI
8.37
Molecular Weight
47773.48
Genbank Protein ID
Genbank Nucleotide ID
Protein Name
Sonic hedgehog protein C-product
Protein Synonyms/Alias
SHH; HHG-1; Sonic hedgehog protein 19 kDa product; Sonic hedgehog protein 27 kDa product;
Gene Name
Shh
Gene Synonyms/Alias
Hhg1;
Created Date
15-JUL-1999
 Lipid Modification Sites 
 Position   Sequence Form   Peptide   References   Modification Type 
25
Canonical
LVCPGLACGPGRGFG
[1][2]
S-Palmitoylation
Organism
Mus musculus (Mouse)
NCBI Taxa ID
10090
Reference
[1] Chamoun Z, Mann RK, Nellen D, von Kessler DP, Bellotto M, Beachy PA, Basler K.Skinny hedgehog, an acyltransferase required for palmitoylation and activity ofthe hedgehog signal. Science. 2001 Sep 14;293(5537):2080-4. Epub 2001 Aug 2.[PMID:11486055]
[2] Chen MH, Li YJ, Kawakami T, Xu SM, Chuang PT. Palmitoylation is required forthe production of a soluble multimeric Hedgehog protein complex and long-rangesignaling in vertebrates. Genes Dev. 2004 Mar 15;18(6):641-59.[PMID:15075292]
Functional Description
Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior- posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Activates the transcription of target genes by interacting with its receptor PTCH1 to prevent normal inhibition by PTCH1 on the constitutive signaling activity of SMO.
Sequence Annotation
Metal binding site: 90 90 Calcium 1.
Metal binding site: 91 91 Calcium 1.
Metal binding site: 91 91 Calcium 2.
Metal binding site: 96 96 Calcium 1.
Metal binding site: 126 126 Calcium 1; via carbonyl oxygen.
Metal binding site: 127 127 Calcium 1.
Metal binding site: 127 127 Calcium 2.
Metal binding site: 130 130 Calcium 2.
Metal binding site: 132 132 Calcium 2.
Metal binding site: 141 141 Zinc.
Metal binding site: 148 148 Zinc.
Metal binding site: 183 183 Zinc.
Functional site: 198 199 Cleavage; by autolysis.
Functional site: 244 244 Involved in cholesterol transfer.
Functional site: 268 268 Involved in auto-cleavage.
Functional site: 271 271 Essential for auto-cleavage.
Protein Length
437 AA.
Protein Sequence
(Canonical)
MLLLLARCFL VILASSLLVC PGLACGPGRG FGKRRHPKKL TPLAYKQFIP NVAEKTLGAS  60
GRYEGKITRN SERFKELTPN YNPDIIFKDE ENTGADRLMT QRCKDKLNAL AISVMNQWPG  120
VKLRVTEGWD EDGHHSEESL HYEGRAVDIT TSDRDRSKYG MLARLAVEAG FDWVYYESKA  180
HIHCSVKAEN SVAAKSGGCF PGSATVHLEQ GGTKLVKDLR PGDRVLAADD QGRLLYSDFL  240
TFLDRDEGAK KVFYVIETLE PRERLLLTAA HLLFVAPHND SGPTPGPSAL FASRVRPGQR  300
VYVVAERGGD RRLLPAAVHS VTLREEEAGA YAPLTAHGTI LINRVLASCY AVIEEHSWAH  360
RAFAPFRLAH ALLAALAPAR TDGGGGGSIP AAQSATEARG AEPTAGIHWY SQLLYHIGTW  420
LLDSETMHPL GMAVKSS                                                 437
FASTA
(Canonical)
>LipidDB-10090-00224|Q62226
MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEARGAEPTAGIHWYSQLLYHIGTW
LLDSETMHPLGMAVKSS
Gene Ontology
GO:0009986; C:cell surface; IDA:MGI
GO:0031012; C:extracellular matrix; IDA:MGI
GO:0005615; C:extracellular space; IDA:MGI
GO:0016020; C:membrane; IDA:MGI
GO:0045121; C:membrane raft; IDA:MGI
GO:0005634; C:nucleus; IDA:MGI
GO:0005886; C:plasma membrane; IEA:UniProtKB-KW
GO:0005509; F:calcium ion binding; ISS:UniProtKB
GO:0001948; F:glycoprotein binding; IDA:MGI
GO:0005539; F:glycosaminoglycan binding; IDA:MGI
GO:0043237; F:laminin-1 binding; IDA:MGI
GO:0005113; F:patched binding; IPI:BHF-UCL
GO:0008270; F:zinc ion binding; ISS:UniProtKB
GO:0048856; P:anatomical structure development; IMP:MGI
GO:0048646; P:anatomical structure formation involved in morphogenesis; IMP:MGI
GO:0008209; P:androgen metabolic process; IMP:MGI
GO:0001525; P:angiogenesis; IDA:MGI
GO:0009952; P:anterior/posterior pattern specification; IMP:MGI
GO:0006915; P:apoptotic process; IGI:MGI
GO:0097190; P:apoptotic signaling pathway; IDA:Roslin
GO:0060840; P:artery development; IMP:MGI
GO:0007411; P:axon guidance; IDA:MGI
GO:0060020; P:Bergmann glial cell differentiation; IDA:MGI
GO:0007596; P:blood coagulation; IMP:MGI
GO:0060442; P:branching involved in prostate gland morphogenesis; IDA:MGI
GO:0060445; P:branching involved in salivary gland morphogenesis; IMP:MGI
GO:0001658; P:branching involved in ureteric bud morphogenesis; IMP:MGI
GO:0048754; P:branching morphogenesis of an epithelial tube; IMP:MGI
GO:0060447; P:bud outgrowth involved in lung branching; IMP:MGI
GO:0043010; P:camera-type eye development; IDA:MGI
GO:0060070; P:canonical Wnt signaling pathway; IDA:MGI
GO:0043369; P:CD4-positive or CD8-positive, alpha-beta T cell lineage commitment; IMP:BHF-UCL
GO:0048468; P:cell development; IMP:MGI
GO:0045165; P:cell fate commitment; IGI:MGI
GO:0001708; P:cell fate specification; IDA:MGI
GO:0008283; P:cell proliferation; IGI:MGI
GO:0007267; P:cell-cell signaling; IMP:MGI
GO:0071285; P:cellular response to lithium ion; IDA:MGI
GO:0007417; P:central nervous system development; IMP:MGI
GO:0021930; P:cerebellar granule cell precursor proliferation; IGI:UniProtKB
GO:0003140; P:determination of left/right asymmetry in lateral mesoderm; IMP:BHF-UCL
GO:0007368; P:determination of left/right symmetry; IMP:MGI
GO:0048589; P:developmental growth; IMP:MGI
GO:0048546; P:digestive tract morphogenesis; IMP:MGI
GO:0021904; P:dorsal/ventral neural tube patterning; IMP:BHF-UCL
GO:0009953; P:dorsal/ventral pattern formation; IGI:MGI
GO:0007398; P:ectoderm development; IMP:MGI
GO:0048557; P:embryonic digestive tract morphogenesis; TAS:BHF-UCL
GO:0042733; P:embryonic digit morphogenesis; IMP:Roslin
GO:0048617; P:embryonic foregut morphogenesis; IMP:MGI
GO:0035115; P:embryonic forelimb morphogenesis; IMP:MGI
GO:0035116; P:embryonic hindlimb morphogenesis; IMP:MGI
GO:0030326; P:embryonic limb morphogenesis; IMP:MGI
GO:0048598; P:embryonic morphogenesis; IMP:MGI
GO:0048568; P:embryonic organ development; IMP:MGI
GO:0048706; P:embryonic skeletal system development; IGI:MGI
GO:0006897; P:endocytosis; IDA:MGI
GO:0060664; P:epithelial cell proliferation involved in salivary gland morphogenesis; IMP:MGI
GO:0060441; P:epithelial tube branching involved in lung morphogenesis; IMP:MGI
GO:0060684; P:epithelial-mesenchymal cell signaling; IMP:MGI
GO:0060738; P:epithelial-mesenchymal signaling involved in prostate gland development; IGI:MGI
GO:0030010; P:establishment of cell polarity; IDA:MGI
GO:0030900; P:forebrain development; IGI:MGI
GO:0048859; P:formation of anatomical boundary; IMP:MGI
GO:0001942; P:hair follicle development; IMP:MGI
GO:0031069; P:hair follicle morphogenesis; IMP:MGI
GO:0007507; P:heart development; IMP:MGI
GO:0001947; P:heart looping; IMP:BHF-UCL
GO:0030902; P:hindbrain development; IMP:MGI
GO:0007442; P:hindgut morphogenesis; IMP:MGI
GO:0048839; P:inner ear development; IMP:MGI
GO:0016539; P:intein-mediated protein splicing; IEA:InterPro
GO:0045109; P:intermediate filament organization; IMP:MGI
GO:0001822; P:kidney development; IMP:MGI
GO:0060459; P:left lung development; IMP:MGI
GO:0060174; P:limb bud formation; IMP:MGI
GO:0060173; P:limb development; IMP:MGI
GO:0030324; P:lung development; IMP:MGI
GO:0060428; P:lung epithelium development; IMP:MGI
GO:0060463; P:lung lobe morphogenesis; IMP:MGI
GO:0060425; P:lung morphogenesis; IMP:MGI
GO:0060484; P:lung-associated mesenchyme development; IMP:MGI
GO:0002320; P:lymphoid progenitor cell differentiation; IMP:BHF-UCL
GO:0030539; P:male genitalia development; IMP:MGI
GO:0010463; P:mesenchymal cell proliferation; IMP:MGI
GO:0060916; P:mesenchymal cell proliferation involved in lung development; IDA:MGI
GO:0060783; P:mesenchymal smoothened signaling pathway involved in prostate gland development; IMP:MGI
GO:0072136; P:metanephric mesenchymal cell proliferation involved in metanephros development; IMP:UniProtKB
GO:0001656; P:metanephros development; IMP:UniProtKB
GO:0030901; P:midbrain development; IGI:MGI
GO:0080125; P:multicellular structure septum development; IMP:MGI
GO:0045445; P:myoblast differentiation; IDA:MGI
GO:0014902; P:myotube differentiation; IMP:MGI
GO:0046639; P:negative regulation of alpha-beta T cell differentiation; IMP:MGI
GO:0043066; P:negative regulation of apoptotic process; IDA:Roslin
GO:0090090; P:negative regulation of canonical Wnt signaling pathway; IMP:MGI
GO:0045596; P:negative regulation of cell differentiation; IDA:MGI
GO:0030336; P:negative regulation of cell migration; IDA:MGI
GO:0090370; P:negative regulation of cholesterol efflux; IMP:BHF-UCL
GO:0010629; P:negative regulation of gene expression; IMP:UniProtKB
GO:2000357; P:negative regulation of kidney smooth muscle cell differentiation; IDA:UniProtKB
GO:2001054; P:negative regulation of mesenchymal cell apoptotic process; IMP:MGI
GO:0032435; P:negative regulation of proteasomal ubiquitin-dependent protein catabolic process; IMP:MGI
GO:0042177; P:negative regulation of protein catabolic process; IMP:MGI
GO:0042130; P:negative regulation of T cell proliferation; IMP:MGI
GO:0034244; P:negative regulation of transcription elongation from RNA polymerase II promoter; IDA:MGI
GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IMP:BHF-UCL
GO:2000062; P:negative regulation of ureter smooth muscle cell differentiation; IDA:UniProtKB
GO:0030178; P:negative regulation of Wnt signaling pathway; IDA:MGI
GO:0045060; P:negative thymic T cell selection; IMP:BHF-UCL
GO:0001755; P:neural crest cell migration; IMP:MGI
GO:0007405; P:neuroblast proliferation; IDA:MGI
GO:0048663; P:neuron fate commitment; IMP:MGI
GO:0042476; P:odontogenesis; IDA:MGI
GO:0042475; P:odontogenesis of dentin-containing tooth; IMP:MGI
GO:0014003; P:oligodendrocyte development; IDA:MGI
GO:0048709; P:oligodendrocyte differentiation; IGI:MGI
GO:0048645; P:organ formation; IMP:MGI
GO:0002076; P:osteoblast development; IDA:MGI
GO:0060021; P:palate development; IMP:MGI
GO:0031016; P:pancreas development; IMP:MGI
GO:0007389; P:pattern specification process; IMP:MGI
GO:0001569; P:patterning of blood vessels; IMP:MGI
GO:0009949; P:polarity specification of anterior/posterior axis; IMP:Roslin
GO:0046638; P:positive regulation of alpha-beta T cell differentiation; IMP:BHF-UCL
GO:0045597; P:positive regulation of cell differentiation; IMP:MGI
GO:0051781; P:positive regulation of cell division; IEA:Ensembl
GO:0008284; P:positive regulation of cell proliferation; IDA:MGI
GO:0021940; P:positive regulation of cerebellar granule cell precursor proliferation; IDA:MGI
GO:0060769; P:positive regulation of epithelial cell proliferation involved in prostate gland development; IMP:MGI
GO:0010628; P:positive regulation of gene expression; IMP:UniProtKB
GO:0007228; P:positive regulation of hh target transcription factor activity; IMP:BHF-UCL
GO:0033092; P:positive regulation of immature T cell proliferation in thymus; IMP:BHF-UCL
GO:2000358; P:positive regulation of kidney smooth muscle cell differentiation; IDA:UniProtKB
GO:0002053; P:positive regulation of mesenchymal cell proliferation; IMP:MGI
GO:2000729; P:positive regulation of mesenchymal cell proliferation involved in ureter development; IMP:UniProtKB
GO:0002052; P:positive regulation of neuroblast proliferation; IDA:MGI
GO:0048714; P:positive regulation of oligodendrocyte differentiation; IDA:MGI
GO:0042307; P:positive regulation of protein import into nucleus; IGI:MGI
GO:0061189; P:positive regulation of sclerotome development; IEA:Ensembl
GO:0014858; P:positive regulation of skeletal muscle cell proliferation; IMP:MGI
GO:0048643; P:positive regulation of skeletal muscle tissue development; IMP:MGI
GO:0045880; P:positive regulation of smoothened signaling pathway; ISS:UniProtKB
GO:0051155; P:positive regulation of striated muscle cell differentiation; IMP:MGI
GO:0033089; P:positive regulation of T cell differentiation in thymus; IMP:BHF-UCL
GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:BHF-UCL
GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB
GO:2000063; P:positive regulation of ureter smooth muscle cell differentiation; IMP:UniProtKB
GO:0030177; P:positive regulation of Wnt signaling pathway; IMP:MGI
GO:0045059; P:positive thymic T cell selection; IMP:BHF-UCL
GO:0060516; P:primary prostatic bud elongation; IDA:MGI
GO:0060523; P:prostate epithelial cord elongation; IDA:MGI
GO:0030850; P:prostate gland development; IMP:MGI
GO:0034504; P:protein localization to nucleus; IDA:MGI
GO:0006508; P:proteolysis; IEA:UniProtKB-KW
GO:0042127; P:regulation of cell proliferation; IDA:MGI
GO:0060768; P:regulation of epithelial cell proliferation involved in prostate gland development; IMP:MGI
GO:0010468; P:regulation of gene expression; IDA:MGI
GO:0060782; P:regulation of mesenchymal cell proliferation involved in prostate gland development; IMP:MGI
GO:0042481; P:regulation of odontogenesis; IMP:BHF-UCL
GO:0060685; P:regulation of prostatic bud formation; IDA:MGI
GO:0030162; P:regulation of proteolysis; IDA:MGI
GO:0006355; P:regulation of transcription, DNA-templated; IMP:MGI
GO:0030323; P:respiratory tube development; IMP:MGI
GO:0060458; P:right lung development; IMP:MGI
GO:0060662; P:salivary gland cavitation; IDA:MGI
GO:0007165; P:signal transduction; TAS:MGI
GO:0043588; P:skin development; IMP:MGI
GO:0007224; P:smoothened signaling pathway; IDA:MGI
GO:0021938; P:smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation; IDA:MGI
GO:0061053; P:somite development; IMP:BHF-UCL
GO:0021513; P:spinal cord dorsal/ventral patterning; IMP:MGI
GO:0021522; P:spinal cord motor neuron differentiation; IGI:MGI
GO:0048864; P:stem cell development; IMP:BHF-UCL
GO:0051146; P:striated muscle cell differentiation; IDA:MGI
GO:0014706; P:striated muscle tissue development; IMP:MGI
GO:0033077; P:T cell differentiation in thymus; IMP:BHF-UCL
GO:0021978; P:telencephalon regionalization; IMP:MGI
GO:0021794; P:thalamus development; IMP:MGI
GO:0048538; P:thymus development; IMP:BHF-UCL
GO:0030878; P:thyroid gland development; IMP:MGI
GO:0060438; P:trachea development; IMP:MGI
GO:0060439; P:trachea morphogenesis; IMP:MGI
GO:0001944; P:vasculature development; IMP:MGI
GO:0001570; P:vasculogenesis; IDA:MGI
GO:0060979; P:vasculogenesis involved in coronary vascular morphogenesis; TAS:DFLAT
Interpro
InterPro; IPR001657; Hedgehog
InterPro; IPR028992; Hedgehog/Intein_dom
InterPro; IPR009045; Hedgehog_sig/DD-Pept_Zn-bd_dom
InterPro; IPR000320; Hedgehog_signalling_dom
InterPro; IPR001767; Hint_dom
InterPro; IPR003586; Hint_dom_C
InterPro; IPR003587; Hint_dom_N
InterPro; IPR006141; Intein_splice_site
Pfam
Pfam; PF01085; HH_signal;
Pfam; PF01079; Hint;
SMART
SMART; SM00305; HintC;
SMART; SM00306; HintN;
PROSITE
PROSITE; PS50817; INTEIN_N_TER;
PRINTS
PRINTS; PR00632; SONICHHOG;